KEGG   Homo sapiens (human): 3554Help
Entry
3554              CDS       T01001                                 

Gene name
IL1R1, CD121A, D2S1473, IL-1R-alpha, IL1R, IL1RA, P80
Definition
(RefSeq) interleukin 1 receptor type 1
  KO
K04386  
interleukin 1 receptor type I
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Osteoclast differentiation
Hematopoietic cell lineage
Th17 cell differentiation
Inflammatory mediator regulation of TRP channels
Amoebiasis
HTLV-I infection
Fluid shear stress and atherosclerosis
Disease
H01492  
Systemic sclerosis
Drug target
Anakinra: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3554 (IL1R1)
   04064 NF-kappa B signaling pathway
    3554 (IL1R1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3554 (IL1R1)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3554 (IL1R1)
   04659 Th17 cell differentiation
    3554 (IL1R1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3554 (IL1R1)
  Development
   04380 Osteoclast differentiation
    3554 (IL1R1)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    3554 (IL1R1)
  Infectious diseases
   05166 HTLV-I infection
    3554 (IL1R1)
   05146 Amoebiasis
    3554 (IL1R1)
Cytokine receptors [BR:hsa04050]
 IL-1 receptor family
  3554 (IL1R1)
Cellular antigens [BR:hsa04090]
 Proteins
  3554 (IL1R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P14778(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
2q11.2-q12.1
AA seq 569 aa AA seqDB search
MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKD
DSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNL
CYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDR
LIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDL
GSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE
IESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIVCSVFIYKIFK
IDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG
YKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQ
DGIKVVLLELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPV
QRRSPSSKHQLLSPATKEKLQREAHVPLG
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgttactcagacttatttgtttcatagctctactgatttcttctctggaggct
gataaatgcaaggaacgtgaagaaaaaataattttagtgtcatctgcaaatgaaattgat
gttcgtccctgtcctcttaacccaaatgaacacaaaggcactataacttggtataaagat
gacagcaagacacctgtatctacagaacaagcctccaggattcatcaacacaaagagaaa
ctttggtttgttcctgctaaggtggaggattcaggacattactattgcgtggtaagaaat
tcatcttactgcctcagaattaaaataagtgcaaaatttgtggagaatgagcctaactta
tgttataatgcacaagccatatttaagcagaaactacccgttgcaggagacggaggactt
gtgtgcccttatatggagttttttaaaaatgaaaataatgagttacctaaattacagtgg
tataaggattgcaaacctctacttcttgacaatatacactttagtggagtcaaagatagg
ctcatcgtgatgaatgtggctgaaaagcatagagggaactatacttgtcatgcatcctac
acatacttgggcaagcaatatcctattacccgggtaatagaatttattactctagaggaa
aacaaacccacaaggcctgtgattgtgagcccagctaatgagacaatggaagtagacttg
ggatcccagatacaattgatctgtaatgtcaccggccagttgagtgacattgcttactgg
aagtggaatgggtcagtaattgatgaagatgacccagtgctaggggaagactattacagt
gtggaaaatcctgcaaacaaaagaaggagtaccctcatcacagtgcttaatatatcggaa
attgaaagtagattttataaacatccatttacctgttttgccaagaatacacatggtata
gatgcagcatatatccagttaatatatccagtcactaatttccagaagcacatgattggt
atatgtgtcacgttgacagtcataattgtgtgttctgttttcatctataaaatcttcaag
attgacattgtgctttggtacagggattcctgctatgattttctcccaataaaagcttca
gatggaaagacctatgacgcatatatactgtatccaaagactgttggggaagggtctacc
tctgactgtgatatttttgtgtttaaagtcttgcctgaggtcttggaaaaacagtgtgga
tataagctgttcatttatggaagggatgactacgttggggaagacattgttgaggtcatt
aatgaaaacgtaaagaaaagcagaagactgattatcattttagtcagagaaacatcaggc
ttcagctggctgggtggttcatctgaagagcaaatagccatgtataatgctcttgttcag
gatggaattaaagttgtcctgcttgagctggagaaaatccaagactatgagaaaatgcca
gaatcgattaaattcattaagcagaaacatggggctatccgctggtcaggggactttaca
cagggaccacagtctgcaaagacaaggttctggaagaatgtcaggtaccacatgccagtc
cagcgacggtcaccttcatctaaacaccagttactgtcaccagccactaaggagaaactg
caaagagaggctcacgtgcctctcgggtag

KEGG   Homo sapiens (human): 7850Help
Entry
7850              CDS       T01001                                 

Gene name
IL1R2, CD121b, CDw121b, IL-1R-2, IL-1RT-2, IL-1RT2, IL1R2c, IL1RB
Definition
(RefSeq) interleukin 1 receptor type 2
  KO
K04387  
interleukin 1 receptor type II
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
Hematopoietic cell lineage
Amoebiasis
HTLV-I infection
Transcriptional misregulation in cancer
Fluid shear stress and atherosclerosis
Drug target
Anakinra: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    7850 (IL1R2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7850 (IL1R2)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    7850 (IL1R2)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    7850 (IL1R2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    7850 (IL1R2)
  Infectious diseases
   05166 HTLV-I infection
    7850 (IL1R2)
   05146 Amoebiasis
    7850 (IL1R2)
Cytokine receptors [BR:hsa04050]
 IL-1 receptor family
  7850 (IL1R2)
Cellular antigens [BR:hsa04090]
 Proteins
  7850 (IL1R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P27930(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2q11.2
AA seq 398 aa AA seqDB search
MLRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWAS
VSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS
IELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDN
EKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVII
SPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQEYSE
NNENYIEVPLIFDPVTREDLHMDFKCVVHNTLSFQTLRTTVKEASSTFSWGIVLAPLSLA
FLVLGGIWMHRRCKHRTGKADGLTVLWPHHQDFQSYPK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcttgtacgtgttggtaatgggagtttctgccttcacccttcagcctgcggca
cacacaggggctgccagaagctgccggtttcgtgggaggcattacaagcgggagttcagg
ctggaaggggagcctgtagccctgaggtgcccccaggtgccctactggttgtgggcctct
gtcagcccccgcatcaacctgacatggcataaaaatgactctgctaggacggtcccagga
gaagaagagacacggatgtgggcccaggacggtgctctgtggcttctgccagccttgcag
gaggactctggcacctacgtctgcactactagaaatgcttcttactgtgacaaaatgtcc
attgagctcagagtttttgagaatacagatgctttcctgccgttcatctcatacccgcaa
attttaaccttgtcaacctctggggtattagtatgccctgacctgagtgaattcacccgt
gacaaaactgacgtgaagattcaatggtacaaggattctcttcttttggataaagacaat
gagaaatttctaagtgtgagggggaccactcacttactcgtacacgatgtggccctggaa
gatgctggctattaccgctgtgtcctgacatttgcccatgaaggccagcaatacaacatc
actaggagtattgagctacgcatcaagaaaaaaaaagaagagaccattcctgtgatcatt
tcccccctcaagaccatatcagcttctctggggtcaagactgacaatcccgtgtaaggtg
tttctgggaaccggcacacccttaaccaccatgctgtggtggacggccaatgacacccac
atagagagcgcctacccgggaggccgcgtgaccgaggggccacgccaggaatattcagaa
aataatgagaactacattgaagtgccattgatttttgatcctgtcacaagagaggatttg
cacatggattttaaatgtgttgtccataataccctgagttttcagacactacgcaccaca
gtcaaggaagcctcctccacgttctcctggggcattgtgctggccccactttcactggcc
ttcttggttttggggggaatatggatgcacagacggtgcaaacacagaactggaaaagca
gatggtctgactgtgctatggcctcatcatcaagactttcaatcctatcccaagtga

DBGET integrated database retrieval system