KEGG   Homo sapiens (human): 3556Help
Entry
3556              CDS       T01001                                 

Gene name
IL1RAP, C3orf13, IL-1RAcP, IL1R3
Definition
interleukin 1 receptor accessory protein
Orthology
K04723  
interleukin 1 receptor accessory protein
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Apoptosis
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3556 (IL1RAP)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    3556 (IL1RAP)
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3556 (IL1RAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q28
AA seq 570 aa AA seqDB search
MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYST
AHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTT
YCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMG
CYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNA
VPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINE
SISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVEL
ACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF
VLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQAL
LELKAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWK
QLQVAMPVKKSPRRSSSDEQGLSYSSLKNV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgacacttctgtggtgtgtagtgagtctctacttttatggaatcctgcaaagtgatgcc
tcagaacgctgcgatgactggggactagacaccatgaggcaaatccaagtgtttgaagat
gagccagctcgcatcaagtgcccactctttgaacacttcttgaaattcaactacagcaca
gcccattcagctggccttactctgatctggtattggactaggcaggaccgggaccttgag
gagccaattaacttccgcctccccgagaaccgcattagtaaggagaaagatgtgctgtgg
ttccggcccactctcctcaatgacactggcaactatacctgcatgttaaggaacactaca
tattgcagcaaagttgcatttcccttggaagttgttcaaaaagacagctgtttcaattcc
cccatgaaactcccagtgcataaactgtatatagaatatggcattcagaggatcacttgt
ccaaatgtagatggatattttccttccagtgtcaaaccgactatcacttggtatatgggc
tgttataaaatacagaattttaataatgtaatacccgaaggtatgaacttgagtttcctc
attgccttaatttcaaataatggaaattacacatgtgttgttacatatccagaaaatgga
cgtacgtttcatctcaccaggactctgactgtaaaggtagtaggctctccaaaaaatgca
gtgccccctgtgatccattcacctaatgatcatgtggtctatgagaaagaaccaggagag
gagctactcattccctgtacggtctattttagttttctgatggattctcgcaatgaggtt
tggtggaccattgatggaaaaaaacctgatgacatcactattgatgtcaccattaacgaa
agtataagtcatagtagaacagaagatgaaacaagaactcagattttgagcatcaagaaa
gttacctctgaggatctcaagcgcagctatgtctgtcatgctagaagtgccaaaggcgaa
gttgccaaagcagccaaggtgaagcagaaagtgccagctccaagatacacagtggaactg
gcttgtggttttggagccacagtcctgctagtggtgattctcattgttgtttaccatgtt
tactggctagagatggtcctattttaccgggctcattttggaacagatgaaaccatttta
gatggaaaagagtatgatatttatgtatcctatgcaaggaatgcggaagaagaagaattt
gtattactgaccctccgtggagttttggagaatgaatttggatacaagctgtgcatcttt
gaccgagacagtctgcctgggggaattgtcacagatgagactttgagcttcattcagaaa
agcagacgcctcctggttgttctaagccccaactacgtgctccagggaacccaagccctc
ctggagctcaaggctggcctagaaaatatggcctctcggggcaacatcaacgtcatttta
gtacagtacaaagctgtgaaggaaacgaaggtgaaagagctgaagagggctaagacggtg
ctcacggtcattaaatggaaaggggaaaaatccaagtatccacagggcaggttctggaag
cagctgcaggtggccatgccagtgaagaaaagtcccaggcggtctagcagtgatgagcag
ggcctctcgtattcatctttgaaaaatgtatga

DBGET integrated database retrieval system