KEGG   Homo sapiens (human): 3556Help
Entry
3556              CDS       T01001                                 

Gene name
IL1RAP, C3orf13, IL-1RAcP, IL1R3
Definition
interleukin 1 receptor accessory protein
Orthology
K04723  
interleukin 1 receptor accessory protein
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Apoptosis
Inflammatory mediator regulation of TRP channels
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hsa04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q28
AA seq 570 aa AA seqDB search
MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYST
AHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTT
YCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMG
CYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNA
VPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINE
SISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVEL
ACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF
VLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQAL
LELKAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWK
QLQVAMPVKKSPRRSSSDEQGLSYSSLKNV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgacacttctgtggtgtgtagtgagtctctacttttatggaatcctgcaaagtgatgcc
tcagaacgctgcgatgactggggactagacaccatgaggcaaatccaagtgtttgaagat
gagccagctcgcatcaagtgcccactctttgaacacttcttgaaattcaactacagcaca
gcccattcagctggccttactctgatctggtattggactaggcaggaccgggaccttgag
gagccaattaacttccgcctccccgagaaccgcattagtaaggagaaagatgtgctgtgg
ttccggcccactctcctcaatgacactggcaactatacctgcatgttaaggaacactaca
tattgcagcaaagttgcatttcccttggaagttgttcaaaaagacagctgtttcaattcc
cccatgaaactcccagtgcataaactgtatatagaatatggcattcagaggatcacttgt
ccaaatgtagatggatattttccttccagtgtcaaaccgactatcacttggtatatgggc
tgttataaaatacagaattttaataatgtaatacccgaaggtatgaacttgagtttcctc
attgccttaatttcaaataatggaaattacacatgtgttgttacatatccagaaaatgga
cgtacgtttcatctcaccaggactctgactgtaaaggtagtaggctctccaaaaaatgca
gtgccccctgtgatccattcacctaatgatcatgtggtctatgagaaagaaccaggagag
gagctactcattccctgtacggtctattttagttttctgatggattctcgcaatgaggtt
tggtggaccattgatggaaaaaaacctgatgacatcactattgatgtcaccattaacgaa
agtataagtcatagtagaacagaagatgaaacaagaactcagattttgagcatcaagaaa
gttacctctgaggatctcaagcgcagctatgtctgtcatgctagaagtgccaaaggcgaa
gttgccaaagcagccaaggtgaagcagaaagtgccagctccaagatacacagtggaactg
gcttgtggttttggagccacagtcctgctagtggtgattctcattgttgtttaccatgtt
tactggctagagatggtcctattttaccgggctcattttggaacagatgaaaccatttta
gatggaaaagagtatgatatttatgtatcctatgcaaggaatgcggaagaagaagaattt
gtattactgaccctccgtggagttttggagaatgaatttggatacaagctgtgcatcttt
gaccgagacagtctgcctgggggaattgtcacagatgagactttgagcttcattcagaaa
agcagacgcctcctggttgttctaagccccaactacgtgctccagggaacccaagccctc
ctggagctcaaggctggcctagaaaatatggcctctcggggcaacatcaacgtcatttta
gtacagtacaaagctgtgaaggaaacgaaggtgaaagagctgaagagggctaagacggtg
ctcacggtcattaaatggaaaggggaaaaatccaagtatccacagggcaggttctggaag
cagctgcaggtggccatgccagtgaagaaaagtcccaggcggtctagcagtgatgagcag
ggcctctcgtattcatctttgaaaaatgtatga

DBGET integrated database retrieval system