KEGG   Homo sapiens (human): 3563Help
Entry
3563              CDS       T01001                                 

Gene name
IL3RA, CD123, IL3R, IL3RAY, IL3RX, IL3RY, hIL-3Ra
Definition
interleukin 3 receptor, alpha (low affinity)
Orthology
K04737  
interleukin 3 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Apoptosis
Jak-STAT signaling pathway
Hematopoietic cell lineage
Drug target
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp22.3 or Yp11.3
AA seq 300 aa AA seqDB search
MVLLWLTLLLIALPCLLQTKEGGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDL
YLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDK
FVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRT
SFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLAL
VCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggtcctcctttggctcacgctgctcctgatcgccctgccctgtctcctgcaaacgaag
gaaggtgggaagccttgggcaggtgcggagaatctgacctgctggattcatgacgtggat
ttcttgagctgcagctgggcggtaggcccgggggcccccgcggacgtccagtacgacctg
tacttgaacgttgccaacaggcgtcaacagtacgagtgtcttcactacaaaacggatgct
cagggaacacgtatcgggtgtcgtttcgatgacatctctcgactctccagcggttctcaa
agttcccacatcctggtgcggggcaggagcgcagccttcggtatcccctgcacagataag
tttgtcgtcttttcacagattgagatattaactccacccaacatgactgcaaagtgtaat
aagacacattcctttatgcactggaaaatgagaagtcatttcaatcgcaaatttcgctat
gagcttcagatacaaaagagaatgcagcctgtaatcacagaacaggtcagagacagaacc
tccttccagctactcaatcctggaacgtacacagtacaaataagagcccgggaaagagtg
tatgaattcttgagcgcctggagcaccccccagcgcttcgagtgcgaccaggaggagggc
gcaaacacacgtgcctggcggacgtcgctgctgatcgcgctggggacgctgctggccctg
gtctgtgtcttcgtgatctgcagaaggtatctggtgatgcagagactctttccccgcatc
cctcacatgaaagaccccatcggtgacagcttccaaaacgacaagctggtggtctgggag
gcgggcaaagccggcctggaggagtgtctggtgactgaagtacaggtcgtgcagaaaact
tga

DBGET integrated database retrieval system