KEGG   Homo sapiens (human): 3563Help
Entry
3563              CDS       T01001                                 

Gene name
IL3RA, CD123, IL3R, IL3RAY, IL3RX, IL3RY, hIL-3Ra
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  
interleukin 3 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Apoptosis
Jak-STAT signaling pathway
Hematopoietic cell lineage
Drug target
Daniplestim: 
Leridistim: 
Milodistim: 
Muplestim: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3563 (IL3RA)
   04151 PI3K-Akt signaling pathway
    3563 (IL3RA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3563 (IL3RA)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    3563 (IL3RA)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3563 (IL3RA)
Cytokine receptors [BR:hsa04050]
 Class I cytokine receptor (hematopoietin family receptor)
  3563 (IL3RA)
Cellular antigens [BR:hsa04090]
 Proteins
  3563 (IL3RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22.3 or Yp11.3
AA seq 378 aa AA seqDB search
MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSM
PAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFL
SCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSS
HILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYEL
QIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGAN
TRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAG
KAGLEECLVTEVQVVQKT
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggtcctcctttggctcacgctgctcctgatcgccctgccctgtctcctgcaaacgaag
gaagatccaaacccaccaatcacgaacctaaggatgaaagcaaaggctcagcagttgacc
tgggaccttaacagaaatgtgaccgatatcgagtgtgttaaagacgccgactattctatg
ccggcagtgaacaatagctattgccagtttggagcaatttccttatgtgaagtgaccaac
tacaccgtccgagtggccaacccaccattctccacgtggatcctcttccctgagaacagt
gggaagccttgggcaggtgcggagaatctgacctgctggattcatgacgtggatttcttg
agctgcagctgggcggtaggcccgggggcccccgcggacgtccagtacgacctgtacttg
aacgttgccaacaggcgtcaacagtacgagtgtcttcactacaaaacggatgctcaggga
acacgtatcgggtgtcgtttcgatgacatctctcgactctccagcggttctcaaagttcc
cacatcctggtgcggggcaggagcgcagccttcggtatcccctgcacagataagtttgtc
gtcttttcacagattgagatattaactccacccaacatgactgcaaagtgtaataagaca
cattcctttatgcactggaaaatgagaagtcatttcaatcgcaaatttcgctatgagctt
cagatacaaaagagaatgcagcctgtaatcacagaacaggtcagagacagaacctccttc
cagctactcaatcctggaacgtacacagtacaaataagagcccgggaaagagtgtatgaa
ttcttgagcgcctggagcaccccccagcgcttcgagtgcgaccaggaggagggcgcaaac
acacgtgcctggcggacgtcgctgctgatcgcgctggggacgctgctggccctggtctgt
gtcttcgtgatctgcagaaggtatctggtgatgcagagactctttccccgcatccctcac
atgaaagaccccatcggtgacagcttccaaaacgacaagctggtggtctgggaggcgggc
aaagccggcctggaggagtgtctggtgactgaagtacaggtcgtgcagaaaacttga

DBGET integrated database retrieval system