KEGG   Homo sapiens (human): 3563Help
Entry
3563              CDS       T01001                                 

Gene name
IL3RA, CD123, IL3R, IL3RAY, IL3RX, IL3RY, hIL-3Ra
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  
interleukin 3 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Apoptosis
Jak-STAT signaling pathway
Hematopoietic cell lineage
Pathways in cancer
Network
N00053  
Cytokine-Jak-STAT signaling pathway
Drug target
Daniplestim: 
Leridistim: 
Milodistim: 
Muplestim: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3563 (IL3RA)
   04151 PI3K-Akt signaling pathway
    3563 (IL3RA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3563 (IL3RA)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    3563 (IL3RA)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3563 (IL3RA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3563 (IL3RA)
Cytokine receptors [BR:hsa04050]
 Class I cytokine receptor (hematopoietin family receptor)
  3563 (IL3RA)
CD molecules [BR:hsa04090]
 Proteins
  3563 (IL3RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P26951(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22.33 and Yp11.2
AA seq 378 aa AA seqDB search
MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSM
PAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFL
SCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSS
HILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYEL
QIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGAN
TRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAG
KAGLEECLVTEVQVVQKT
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggtcctcctttggctcacgctgctcctgatcgccctgccctgtctcctgcaaacgaag
gaagatccaaacccaccaatcacgaacctaaggatgaaagcaaaggctcagcagttgacc
tgggaccttaacagaaatgtgaccgatatcgagtgtgttaaagacgccgactattctatg
ccggcagtgaacaatagctattgccagtttggagcaatttccttatgtgaagtgaccaac
tacaccgtccgagtggccaacccaccattctccacgtggatcctcttccctgagaacagt
gggaagccttgggcaggtgcggagaatctgacctgctggattcatgacgtggatttcttg
agctgcagctgggcggtaggcccgggggcccccgcggacgtccagtacgacctgtacttg
aacgttgccaacaggcgtcaacagtacgagtgtcttcactacaaaacggatgctcaggga
acacgtatcgggtgtcgtttcgatgacatctctcgactctccagcggttctcaaagttcc
cacatcctggtgcggggcaggagcgcagccttcggtatcccctgcacagataagtttgtc
gtcttttcacagattgagatattaactccacccaacatgactgcaaagtgtaataagaca
cattcctttatgcactggaaaatgagaagtcatttcaatcgcaaatttcgctatgagctt
cagatacaaaagagaatgcagcctgtaatcacagaacaggtcagagacagaacctccttc
cagctactcaatcctggaacgtacacagtacaaataagagcccgggaaagagtgtatgaa
ttcttgagcgcctggagcaccccccagcgcttcgagtgcgaccaggaggagggcgcaaac
acacgtgcctggcggacgtcgctgctgatcgcgctggggacgctgctggccctggtctgt
gtcttcgtgatctgcagaaggtatctggtgatgcagagactctttccccgcatccctcac
atgaaagaccccatcggtgacagcttccaaaacgacaagctggtggtctgggaggcgggc
aaagccggcctggaggagtgtctggtgactgaagtacaggtcgtgcagaaaacttga

DBGET integrated database retrieval system