KEGG   Homo sapiens (human): 3568Help
Entry
3568              CDS       T01001                                 

Gene name
IL5RA, CD125, CDw125, HSIL5R3, IL5R
Definition
interleukin 5 receptor, alpha
Orthology
K05067  
interleukin 5 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Hematopoietic cell lineage
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3568 (IL5RA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3568 (IL5RA)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3568 (IL5RA)
Cellular antigens [BR:hsa04090]
 Proteins
  3568 (IL5RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p26-p24
AA seq 420 aa AA seqDB search
MIIVAHVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRN
VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHA
PPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQIN
PPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDD
LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDEHKPLREWFVIVIMATICFILLILSL
ICKICHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDSVF
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgtggcgcatgtattactcatccttttgggggccactgagatactgcaagct
gacttacttcctgatgaaaagatttcacttctcccacctgtcaatttcaccattaaagtt
actggtttggctcaagttcttttacaatggaaaccaaatcctgatcaagagcaaaggaat
gttaatctagaatatcaagtgaaaataaacgctccaaaagaagatgactatgaaaccaga
atcactgaaagcaaatgtgtaaccatcctccacaaaggcttttcagcaagtgtgcggacc
atcctgcagaacgaccactcactactggccagcagctgggcttctgctgaacttcatgcc
ccaccagggtctcctggaacctcaattgtgaatttaacttgcaccacaaacactacagaa
gacaattattcacgtttaaggtcataccaagtttcccttcactgcacctggcttgttggc
acagatgcccctgaggacacgcagtattttctctactataggtatggctcttggactgaa
gaatgccaagaatacagcaaagacacactggggagaaatatcgcatgctggtttcccagg
acttttatcctcagcaaagggcgtgactggcttgcggtgcttgttaacggctccagcaag
cactctgctatcaggccctttgatcagctgtttgcccttcacgccattgatcaaataaat
cctccactgaatgtcacagcagagattgaaggaactcgtctctctatccaatgggagaaa
ccagtgtctgcttttccaatccattgctttgattatgaagtaaaaatacacaatacaagg
aatggatatttgcagatagaaaaattgatgaccaatgcattcatctcaataattgatgat
ctttctaagtacgatgttcaagtgagagcagcagtgagctccatgtgcagagaggcaggg
ctctggagtgagtggagccaacctatttatgtgggaaatgatgaacacaagcccttgaga
gagtggtttgtcattgtgattatggcaaccatctgcttcatcttgttaattctctcgctt
atctgtaaaatatgtcatttatggatcaagttgtttccaccaattccagcaccaaaaagt
aatatcaaagatctctttgtaaccactaactatgagaaagctgggtccagtgagacggaa
attgaagtcatctgttatatagagaagcctggagttgagaccctggaggattctgtgttt
tga

DBGET integrated database retrieval system