KEGG   Homo sapiens (human): 3572Help
Entry
3572              CDS       T01001                                 

Gene name
IL6ST, CD130, CDW130, GP130, IL-6RB
Definition
interleukin 6 signal transducer (gp130, oncostatin M receptor)
Orthology
K05060  
interleukin 6 signal transducer
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q11.2
AA seq 857 aa AA seqDB search
MLTLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHV
NANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITI
ISGLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPT
SCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSIL
KLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEAN
GKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACD
FQGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQ
LPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGK
DGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSKS
HIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKINT
EGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVVHSGYRHQVPSVQVFSRSE
STQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISHFERSKQVSSVN
EEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVGMEAATDEGM
PKSYLPQTVRQGGYMPQ
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgttgacgttgcagacttggctagtgcaagccttgtttattttcctcaccactgaatct
acaggtgaacttctagatccatgtggttatatcagtcctgaatctccagttgtacaactt
cattctaatttcactgcagtttgtgtgctaaaggaaaaatgtatggattattttcatgta
aatgctaattacattgtctggaaaacaaaccattttactattcctaaggagcaatatact
atcataaacagaacagcatccagtgtcacctttacagatatagcttcattaaatattcag
ctcacttgcaacattcttacattcggacagcttgaacagaatgtttatggaatcacaata
atttcaggcttgcctccagaaaaacctaaaaatttgagttgcattgtgaacgaggggaag
aaaatgaggtgtgagtgggatggtggaagggaaacacacttggagacaaacttcacttta
aaatctgaatgggcaacacacaagtttgctgattgcaaagcaaaacgtgacacccccacc
tcatgcactgttgattattctactgtgtattttgtcaacattgaagtctgggtagaagca
gagaatgcccttgggaaggttacatcagatcatatcaattttgatcctgtatataaagtg
aagcccaatccgccacataatttatcagtgatcaactcagaggaactgtctagtatctta
aaattgacatggaccaacccaagtattaagagtgttataatactaaaatataacattcaa
tataggaccaaagatgcctcaacttggagccagattcctcctgaagacacagcatccacc
cgatcttcattcactgtccaagaccttaaaccttttacagaatatgtgtttaggattcgc
tgtatgaaggaagatggtaagggatactggagtgactggagtgaagaagcaagtgggatc
acctatgaagatagaccatctaaagcaccaagtttctggtataaaatagatccatcccat
actcaaggctacagaactgtacaactcgtgtggaagacattgcctccttttgaagccaat
ggaaaaatcttggattatgaagtgactctcacaagatggaaatcacatttacaaaattac
acagttaatgccacaaaactgacagtaaatctcacaaatgatcgctatctagcaacccta
acagtaagaaatcttgttggcaaatcagatgcagctgttttaactatccctgcctgtgac
tttcaagggaacttagcagagagcaaatgctatttgataacagttactccagtatatgct
gatggaccaggaagccctgaatccataaaggcataccttaaacaagctccaccttccaaa
ggacctactgttcggacaaaaaaagtagggaaaaacgaagctgtcttagagtgggaccaa
cttcctgttgatgttcagaatggatttatcagaaattatactatattttatagaaccatc
attggaaatgaaactgctgtgaatgtggattcttcccacacagaatatacattgtcctct
ttgactagtgacacattgtacatggtacgaatggcagcatacacagatgaaggtgggaag
gatggtccagaattcacttttactaccccaaagtttgctcaaggagaaattgaagccata
gtcgtgcctgtttgcttagcattcctattgacaactcttctgggagtgctgttctgcttt
aataagcgagacctaattaaaaaacacatctggcctaatgttccagatccttcaaagagt
catattgcccagtggtcacctcacactcctccaaggcacaattttaattcaaaagatcaa
atgtattcagatggcaatttcactgatgtaagtgttgtggaaatagaagcaaatgacaaa
aagccttttccagaagatctgaaatcattggacctgttcaaaaaggaaaaaattaatact
gaaggacacagcagtggtattggggggtcttcatgcatgtcatcttctaggccaagcatt
tctagcagtgatgaaaatgaatcttcacaaaacacttcgagcactgtccagtattctacc
gtggtacacagtggctacagacaccaagttccgtcagtccaagtcttctcaagatccgag
tctacccagcccttgttagattcagaggagcggccagaagatctacaattagtagatcat
gtagatggcggtgatggtattttgcccaggcaacagtacttcaaacagaactgcagtcag
catgaatccagtccagatatttcacattttgaaaggtcaaagcaagtttcatcagtcaat
gaggaagattttgttagacttaaacagcagatttcagatcatatttcacaatcctgtgga
tctgggcaaatgaaaatgtttcaggaagtttctgcagcagatgcttttggtccaggtact
gagggacaagtagaaagatttgaaacagttggcatggaggctgcgactgatgaaggcatg
cctaaaagttacttaccacagactgtacggcaaggcggctacatgcctcagtga

DBGET integrated database retrieval system