KEGG   Homo sapiens (human): 3572Help
Entry
3572              CDS       T01001                                 

Gene name
IL6ST, CD130, CDW130, GP130, IL-6RB
Definition
interleukin 6 signal transducer
Orthology
K05060  
interleukin 6 signal transducer
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3572 (IL6ST)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3572 (IL6ST)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    3572 (IL6ST)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    3572 (IL6ST)
Cellular antigens [BR:hsa04090]
 Proteins
  3572 (IL6ST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q11.2
AA seq 857 aa AA seqDB search
MLTLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHV
NANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITI
ISGLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPT
SCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSIL
KLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEAN
GKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACD
FQGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQ
LPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGK
DGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSKS
HIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKINT
EGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVVHSGYRHQVPSVQVFSRSE
STQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISHFERSKQVSSVN
EEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVGMEAATDEGM
PKSYLPQTVRQGGYMPQ
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgttgacgttgcagacttggctagtgcaagccttgtttattttcctcaccactgaatct
acaggtgaacttctagatccatgtggttatatcagtcctgaatctccagttgtacaactt
cattctaatttcactgcagtttgtgtgctaaaggaaaaatgtatggattattttcatgta
aatgctaattacattgtctggaaaacaaaccattttactattcctaaggagcaatatact
atcataaacagaacagcatccagtgtcacctttacagatatagcttcattaaatattcag
ctcacttgcaacattcttacattcggacagcttgaacagaatgtttatggaatcacaata
atttcaggcttgcctccagaaaaacctaaaaatttgagttgcattgtgaacgaggggaag
aaaatgaggtgtgagtgggatggtggaagggaaacacacttggagacaaacttcacttta
aaatctgaatgggcaacacacaagtttgctgattgcaaagcaaaacgtgacacccccacc
tcatgcactgttgattattctactgtgtattttgtcaacattgaagtctgggtagaagca
gagaatgcccttgggaaggttacatcagatcatatcaattttgatcctgtatataaagtg
aagcccaatccgccacataatttatcagtgatcaactcagaggaactgtctagtatctta
aaattgacatggaccaacccaagtattaagagtgttataatactaaaatataacattcaa
tataggaccaaagatgcctcaacttggagccagattcctcctgaagacacagcatccacc
cgatcttcattcactgtccaagaccttaaaccttttacagaatatgtgtttaggattcgc
tgtatgaaggaagatggtaagggatactggagtgactggagtgaagaagcaagtgggatc
acctatgaagatagaccatctaaagcaccaagtttctggtataaaatagatccatcccat
actcaaggctacagaactgtacaactcgtgtggaagacattgcctccttttgaagccaat
ggaaaaatcttggattatgaagtgactctcacaagatggaaatcacatttacaaaattac
acagttaatgccacaaaactgacagtaaatctcacaaatgatcgctatctagcaacccta
acagtaagaaatcttgttggcaaatcagatgcagctgttttaactatccctgcctgtgac
tttcaagggaacttagcagagagcaaatgctatttgataacagttactccagtatatgct
gatggaccaggaagccctgaatccataaaggcataccttaaacaagctccaccttccaaa
ggacctactgttcggacaaaaaaagtagggaaaaacgaagctgtcttagagtgggaccaa
cttcctgttgatgttcagaatggatttatcagaaattatactatattttatagaaccatc
attggaaatgaaactgctgtgaatgtggattcttcccacacagaatatacattgtcctct
ttgactagtgacacattgtacatggtacgaatggcagcatacacagatgaaggtgggaag
gatggtccagaattcacttttactaccccaaagtttgctcaaggagaaattgaagccata
gtcgtgcctgtttgcttagcattcctattgacaactcttctgggagtgctgttctgcttt
aataagcgagacctaattaaaaaacacatctggcctaatgttccagatccttcaaagagt
catattgcccagtggtcacctcacactcctccaaggcacaattttaattcaaaagatcaa
atgtattcagatggcaatttcactgatgtaagtgttgtggaaatagaagcaaatgacaaa
aagccttttccagaagatctgaaatcattggacctgttcaaaaaggaaaaaattaatact
gaaggacacagcagtggtattggggggtcttcatgcatgtcatcttctaggccaagcatt
tctagcagtgatgaaaatgaatcttcacaaaacacttcgagcactgtccagtattctacc
gtggtacacagtggctacagacaccaagttccgtcagtccaagtcttctcaagatccgag
tctacccagcccttgttagattcagaggagcggccagaagatctacaattagtagatcat
gtagatggcggtgatggtattttgcccaggcaacagtacttcaaacagaactgcagtcag
catgaatccagtccagatatttcacattttgaaaggtcaaagcaagtttcatcagtcaat
gaggaagattttgttagacttaaacagcagatttcagatcatatttcacaatcctgtgga
tctgggcaaatgaaaatgtttcaggaagtttctgcagcagatgcttttggtccaggtact
gagggacaagtagaaagatttgaaacagttggcatggaggctgcgactgatgaaggcatg
cctaaaagttacttaccacagactgtacggcaaggcggctacatgcctcagtga

DBGET integrated database retrieval system