KEGG   Homo sapiens (human): 3572Help
Entry
3572              CDS       T01001                                 

Gene name
IL6ST, CD130, CDW130, GP130, IL-6RB
Definition
(RefSeq) interleukin 6 signal transducer
  KO
K05060  
interleukin 6 signal transducer
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Signaling pathways regulating pluripotency of stem cells
Jak-STAT signaling pathway
Th17 cell differentiation
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3572 (IL6ST)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3572 (IL6ST)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3572 (IL6ST)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    3572 (IL6ST)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    3572 (IL6ST)
Cytokine receptors [BR:hsa04050]
 Class I cytokine receptor (hematopoietin family receptor)
  3572 (IL6ST)
Cellular antigens [BR:hsa04090]
 Proteins
  3572 (IL6ST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P40189(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
5q11.2
AA seq 918 aa AA seqDB search
MLTLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHV
NANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITI
ISGLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPT
SCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSIL
KLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEAN
GKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACD
FQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRT
YLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWD
QLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKIN
TEGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVVHSGYRHQVPSVQVFSRS
ESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISHFERSKQVSSV
NEEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVGMEAATDEG
MPKSYLPQTVRQGGYMPQ
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgttgacgttgcagacttggctagtgcaagccttgtttattttcctcaccactgaatct
acaggtgaacttctagatccatgtggttatatcagtcctgaatctccagttgtacaactt
cattctaatttcactgcagtttgtgtgctaaaggaaaaatgtatggattattttcatgta
aatgctaattacattgtctggaaaacaaaccattttactattcctaaggagcaatatact
atcataaacagaacagcatccagtgtcacctttacagatatagcttcattaaatattcag
ctcacttgcaacattcttacattcggacagcttgaacagaatgtttatggaatcacaata
atttcaggcttgcctccagaaaaacctaaaaatttgagttgcattgtgaacgaggggaag
aaaatgaggtgtgagtgggatggtggaagggaaacacacttggagacaaacttcacttta
aaatctgaatgggcaacacacaagtttgctgattgcaaagcaaaacgtgacacccccacc
tcatgcactgttgattattctactgtgtattttgtcaacattgaagtctgggtagaagca
gagaatgcccttgggaaggttacatcagatcatatcaattttgatcctgtatataaagtg
aagcccaatccgccacataatttatcagtgatcaactcagaggaactgtctagtatctta
aaattgacatggaccaacccaagtattaagagtgttataatactaaaatataacattcaa
tataggaccaaagatgcctcaacttggagccagattcctcctgaagacacagcatccacc
cgatcttcattcactgtccaagaccttaaaccttttacagaatatgtgtttaggattcgc
tgtatgaaggaagatggtaagggatactggagtgactggagtgaagaagcaagtgggatc
acctatgaagatagaccatctaaagcaccaagtttctggtataaaatagatccatcccat
actcaaggctacagaactgtacaactcgtgtggaagacattgcctccttttgaagccaat
ggaaaaatcttggattatgaagtgactctcacaagatggaaatcacatttacaaaattac
acagttaatgccacaaaactgacagtaaatctcacaaatgatcgctatctagcaacccta
acagtaagaaatcttgttggcaaatcagatgcagctgttttaactatccctgcctgtgac
tttcaagctactcaccctgtaatggatcttaaagcattccccaaagataacatgctttgg
gtggaatggactactccaagggaatctgtaaagaaatatatacttgagtggtgtgtgtta
tcagataaagcaccctgtatcacagactggcaacaagaagatggtaccgtgcatcgcacc
tatttaagagggaacttagcagagagcaaatgctatttgataacagttactccagtatat
gctgatggaccaggaagccctgaatccataaaggcataccttaaacaagctccaccttcc
aaaggacctactgttcggacaaaaaaagtagggaaaaacgaagctgtcttagagtgggac
caacttcctgttgatgttcagaatggatttatcagaaattatactatattttatagaacc
atcattggaaatgaaactgctgtgaatgtggattcttcccacacagaatatacattgtcc
tctttgactagtgacacattgtacatggtacgaatggcagcatacacagatgaaggtggg
aaggatggtccagaattcacttttactaccccaaagtttgctcaaggagaaattgaagcc
atagtcgtgcctgtttgcttagcattcctattgacaactcttctgggagtgctgttctgc
tttaataagcgagacctaattaaaaaacacatctggcctaatgttccagatccttcaaag
agtcatattgcccagtggtcacctcacactcctccaaggcacaattttaattcaaaagat
caaatgtattcagatggcaatttcactgatgtaagtgttgtggaaatagaagcaaatgac
aaaaagccttttccagaagatctgaaatcattggacctgttcaaaaaggaaaaaattaat
actgaaggacacagcagtggtattggggggtcttcatgcatgtcatcttctaggccaagc
atttctagcagtgatgaaaatgaatcttcacaaaacacttcgagcactgtccagtattct
accgtggtacacagtggctacagacaccaagttccgtcagtccaagtcttctcaagatcc
gagtctacccagcccttgttagattcagaggagcggccagaagatctacaattagtagat
catgtagatggcggtgatggtattttgcccaggcaacagtacttcaaacagaactgcagt
cagcatgaatccagtccagatatttcacattttgaaaggtcaaagcaagtttcatcagtc
aatgaggaagattttgttagacttaaacagcagatttcagatcatatttcacaatcctgt
ggatctgggcaaatgaaaatgtttcaggaagtttctgcagcagatgcttttggtccaggt
actgagggacaagtagaaagatttgaaacagttggcatggaggctgcgactgatgaaggc
atgcctaaaagttacttaccacagactgtacggcaaggcggctacatgcctcagtga

DBGET integrated database retrieval system