KEGG   Homo sapiens (human): 3577Help
Entry
3577              CDS       T01001                                 

Gene name
CXCR1, C-C, C-C-CKR-1, CD128, CD181, CDw128a, CKR-1, CMKAR1, IL8R1, IL8RA, IL8RBA
Definition
chemokine (C-X-C motif) receptor 1
Orthology
K04175  
interleukin 8 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Endocytosis
Epithelial cell signaling in Helicobacter pylori infection
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3577 (CXCR1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3577 (CXCR1)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    3577 (CXCR1)
 Human Diseases
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3577 (CXCR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CXC Chemokine
    3577 (CXCR1)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   3577 (CXCR1)
Cellular antigens [BR:hsa04090]
 Proteins
  3577 (CXCR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q35
AA seq 350 aa AA seqDB search
MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatattacagatccacagatgtgggattttgatgatctaaatttcactggcatg
ccacctgcagatgaagattacagcccctgtatgctagaaactgagacactcaacaagtat
gttgtgatcatcgcctatgccctagtgttcctgctgagcctgctgggaaactccctggtg
atgctggtcatcttatacagcagggtcggccgctccgtcactgatgtctacctgctgaac
ctggccttggccgacctactctttgccctgaccttgcccatctgggccgcctccaaggtg
aatggctggatttttggcacattcctgtgcaaggtggtctcactcctgaaggaagtcaac
ttctacagtggcatcctgctgttggcctgcatcagtgtggaccgttacctggccattgtc
catgccacacgcacactgacccagaagcgtcacttggtcaagtttgtttgtcttggctgc
tggggactgtctatgaatctgtccctgcccttcttccttttccgccaggcttaccatcca
aacaattccagtccagtttgctatgaggtcctgggaaatgacacagcaaaatggcggatg
gtgttgcggatcctgcctcacacctttggcttcatcgtgccgctgtttgtcatgctgttc
tgctatggattcaccctgcgtacactgtttaaggcccacatggggcagaagcaccgagcc
atgagggtcatctttgctgtcgtcctcatcttcctgctttgctggctgccctacaacctg
gtcctgctggcagacaccctcatgaggacccaggtgatccaggagagctgtgagcgccgc
aacaacatcggccgggccctggatgccactgagattctgggatttctccatagctgcctc
aaccccatcatctacgccttcatcggccaaaattttcgccatggattcctcaagatcctg
gctatgcatggcctggtcagcaaggagttcttggcacgtcatcgtgttacctcctacact
tcttcgtctgtcaatgtctcttccaacctctga

DBGET integrated database retrieval system