KEGG   Homo sapiens (human): 3578Help
Entry
3578              CDS       T01001                                 

Gene name
IL9, HP40, IL-9, P40
Definition
interleukin 9
Orthology
K05432  
interleukin 9
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Asthma
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3578 (IL9)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3578 (IL9)
 Human Diseases
  Immune diseases
   05310 Asthma
    3578 (IL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31.1
AA seq 144 aa AA seqDB search
MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIP
SDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGN
ALTFLKSLLEIFQKEKMRGMRGKI
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgcttctggccatggtccttacctctgccctgctcctgtgctccgtggcaggccagggg
tgtccaaccttggcggggatcctggacatcaacttcctcatcaacaagatgcaggaagat
ccagcttccaagtgccactgcagtgctaatgtgaccagttgtctctgtttgggcattccc
tctgacaactgcaccagaccatgcttcagtgagagactgtctcagatgaccaataccacc
atgcaaacaagatacccactgattttcagtcgggtgaaaaaatcagttgaagtactaaag
aacaacaagtgtccatatttttcctgtgaacagccatgcaaccaaaccacggcaggcaac
gcgctgacatttctgaagagtcttctggaaattttccagaaagaaaagatgagagggatg
agaggcaagatatga

DBGET integrated database retrieval system