KEGG   Homo sapiens (human): 3579Help
Entry
3579              CDS       T01001                                 

Gene name
CXCR2, CD182, CDw128b, CMKAR2, IL8R2, IL8RA, IL8RB
Definition
chemokine (C-X-C motif) receptor 2
Orthology
K05050  
interleukin 8 receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Endocytosis
Epithelial cell signaling in Helicobacter pylori infection
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3579 (CXCR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3579 (CXCR2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    3579 (CXCR2)
 Human Diseases
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3579 (CXCR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CXC Chemokine
    3579 (CXCR2)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   3579 (CXCR2)
Cellular antigens [BR:hsa04090]
 Proteins
  3579 (CXCR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q35
AA seq 360 aa AA seqDB search
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggaagattttaacatggagagtgacagctttgaagatttctggaaaggtgaagatctt
agtaattacagttacagctctaccctgcccccttttctactagatgccgccccatgtgaa
ccagaatccctggaaatcaacaagtattttgtggtcattatctatgccctggtattcctg
ctgagcctgctgggaaactccctcgtgatgctggtcatcttatacagcagggtcggccgc
tccgtcactgatgtctacctgctgaacctagccttggccgacctactctttgccctgacc
ttgcccatctgggccgcctccaaggtgaatggctggatttttggcacattcctgtgcaag
gtggtctcactcctgaaggaagtcaacttctatagtggcatcctgctactggcctgcatc
agtgtggaccgttacctggccattgtccatgccacacgcacactgacccagaagcgctac
ttggtcaaattcatatgtctcagcatctggggtctgtccttgctcctggccctgcctgtc
ttacttttccgaaggaccgtctactcatccaatgttagcccagcctgctatgaggacatg
ggcaacaatacagcaaactggcggatgctgttacggatcctgccccagtcctttggcttc
atcgtgccactgctgatcatgctgttctgctacggattcaccctgcgtacgctgtttaag
gcccacatggggcagaagcaccgggccatgcgggtcatctttgctgtcgtcctcatcttc
ctgctctgctggctgccctacaacctggtcctgctggcagacaccctcatgaggacccag
gtgatccaggagacctgtgagcgccgcaatcacatcgaccgggctctggatgccaccgag
attctgggcatccttcacagctgcctcaaccccctcatctacgccttcattggccagaag
tttcgccatggactcctcaagattctagctatacatggcttgatcagcaaggactccctg
cccaaagacagcaggccttcctttgttggctcttcttcagggcacacttccactactctc
taa

DBGET integrated database retrieval system