KEGG   Homo sapiens (human): 358Help
Entry
358               CDS       T01001                                 

Gene name
AQP1, AQP-CHIP, CHIP28, CO
Definition
aquaporin 1 (Colton blood group)
Orthology
K09864  
aquaporin-1
Organism
hsa  Homo sapiens (human)
Pathway
Proximal tubule bicarbonate reclamation
Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    358 (AQP1)
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    358 (AQP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   358 (AQP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p14
AA seq 186 aa AA seqDB search
MPGARPLPLVLVPQNTLAWMQLDAKAPAHPRPLQLLGRVGPGSRQLADGVNSGQGLGIEI
IGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVIT
HNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSR
VEMKPK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcctggggctcgccccttgcctctggtcttggtaccccagaataccctggcctggatg
cagctggatgcaaaggccccagctcaccccaggcctctccagcttctaggcagagtgggg
cctgggtctaggcagctggctgatggtgtgaactcgggccagggcctgggcatcgagatc
atcgggaccctccagctggtgctatgcgtgctggctactaccgaccggaggcgccgtgac
cttggtggctcagccccccttgccatcggcctctctgtagcccttggacacctcctggct
attgactacactggctgtgggattaaccctgctcggtcctttggctccgcggtgatcaca
cacaacttcagcaaccactggattttctgggtggggccattcatcgggggagccctggct
gtactcatctacgacttcatcctggccccacgcagcagtgacctcacagaccgcgtgaag
gtgtggaccagcggccaggtggaggagtatgacctggatgccgacgacatcaactccagg
gtggagatgaagcccaaatag

DBGET integrated database retrieval system