KEGG   Homo sapiens (human): 358Help
Entry
358               CDS       T01001                                 

Gene name
AQP1, AQP-CHIP, CHIP28, CO
Definition
(RefSeq) aquaporin 1 (Colton blood group) (EC:2.7.1.21)
  KO
K09864  
aquaporin-1
Organism
hsa  Homo sapiens (human)
Pathway
Renin secretion
Proximal tubule bicarbonate reclamation
Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    358 (AQP1)
  Digestive system
   04976 Bile secretion
    358 (AQP1)
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    358 (AQP1)
Transporters [BR:hsa02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    358 (AQP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   358 (AQP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p14
AA seq 269 aa AA seqDB search
MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNVKVSLAFGLSI
ATLAQSVGHISGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLT
GNSLGRNDLADGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGH
LLAIDYTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTD
RVKVWTSGQVEEYDLDADDINSRVEMKPK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgagttcaagaagaagctcttctggagggcagtggtggccgagttcctggcc
acgaccctctttgtcttcatcagcatcggttctgccctgggcttcaaatacccggtgggg
aacaaccagacggcggtccaggacaacgtgaaggtgtcgctggccttcgggctgagcatc
gccacgctggcgcagagtgtgggccacatcagcggcgcccacctcaacccggctgtcaca
ctggggctgctgctcagctgccagatcagcatcttccgtgccctcatgtacatcatcgcc
cagtgcgtgggggccatcgtcgccaccgccatcctctcaggcatcacctcctccctgact
gggaactcgcttggccgcaatgacctggctgatggtgtgaactcgggccagggcctgggc
atcgagatcatcgggaccctccagctggtgctatgcgtgctggctactaccgaccggagg
cgccgtgaccttggtggctcagccccccttgccatcggcctctctgtagcccttggacac
ctcctggctattgactacactggctgtgggattaaccctgctcggtcctttggctccgcg
gtgatcacacacaacttcagcaaccactggattttctgggtggggccattcatcggggga
gccctggctgtactcatctacgacttcatcctggccccacgcagcagtgacctcacagac
cgcgtgaaggtgtggaccagcggccaggtggaggagtatgacctggatgccgacgacatc
aactccagggtggagatgaagcccaaatag

DBGET integrated database retrieval system