KEGG   Homo sapiens (human): 3581Help
Entry
3581              CDS       T01001                                 

Gene name
IL9R, CD129, IL-9R
Definition
interleukin 9 receptor
Orthology
K05073  
interleukin 9 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3581 (IL9R)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3581 (IL9R)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3581 (IL9R)
Cellular antigens [BR:hsa04090]
 Proteins
  3581 (IL9R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28 and Yq12
AA seq 521 aa AA seqDB search
MGLGRCIWEGWTLESEALRRDMGTWLLACICICTCVCLGVSVTGEGQGPRSRTFTCLTNN
ILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTI
TFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLS
YELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEER
YTGQWSEWSQPVCFQAPQRQGPLIPPWGWPGNTLVAVSIFLLLTGPTYLLFKLSPRVKRI
FYQNVPSPAMFFQPLYSVHNGNFQTWMGAHGAGVLLSQDCAGTPQGALEPCVQEATALLT
CGPARPWKSVALEEEQEGPGTRLPGNLSSEDVLPAGCTEWRVQTLAYLPQEDWAPTSLTR
PAPPDSEGSRSSSSSSSSNNNNYCALGCYGGWHLSALPGNTQSSGPIPALACGLSCDHQG
LETQQGVAWVLAGHCQRPGLHEDLQGMLLPSVLSKARSWTF
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgggactgggcagatgcatctgggaaggctggaccttggagagtgaggccctgaggcga
gacatgggcacctggctcctggcctgcatctgcatctgcacctgtgtctgcttgggagtc
tctgtcacaggggaaggacaagggccaaggtctagaaccttcacctgcctcaccaacaac
attctcaggatcgattgccactggtctgccccagagctgggacagggctccagcccctgg
ctcctcttcaccagcaaccaggctcctggcggcacacataagtgcatcttgcggggcagt
gagtgcaccgtcgtgctgccacctgaggcagtgctcgtgccatctgacaatttcaccatc
actttccaccactgcatgtctgggagggagcaggtcagcctggtggacccggagtacctg
ccccggagacacgttaagctggacccgccctctgacttgcagagcaacatcagttctggc
cactgcatcctgacctggagcatcagtcctgccttggagccaatgaccacacttctcagc
tatgagctggccttcaagaagcaggaagaggcctgggagcaggcccagcacagggatcac
attgtcggggtgacctggcttatacttgaagcctttgagctggaccctggctttatccat
gaggccaggctgcgtgtccagatggccacactggaggatgatgtggtagaggaggagcgt
tatacaggccagtggagtgagtggagccagcctgtgtgcttccaggctccccagagacaa
ggccctctgatcccaccctgggggtggccaggcaacacccttgttgctgtgtccatcttt
ctcctgctgactggcccgacctacctcctgttcaagctgtcgcccagggtgaagagaatc
ttctaccagaacgtgccctctccagcgatgttcttccagcccctctacagtgtacacaat
gggaacttccagacttggatgggggcccacggggccggtgtgctgttgagccaggactgt
gctggcaccccacagggagccttggagccctgcgtccaggaggccactgcactgctcact
tgtggcccagcgcgtccttggaaatctgtggccctggaggaggaacaggagggccctggg
accaggctcccggggaacctgagctcagaggatgtgctgccagcagggtgtacggagtgg
agggtacagacgcttgcctatctgccacaggaggactgggcccccacgtccctgactagg
ccggctcccccagactcagagggcagcaggagcagcagcagcagcagcagcagcaacaac
aacaactactgtgccttgggctgctatgggggatggcacctctcagccctcccaggaaac
acacagagctctgggcccatcccagccctggcctgtggcctttcttgtgaccatcagggc
ctggagacccagcaaggagttgcctgggtgctggctggtcactgccagaggcctgggctg
catgaggacctccagggcatgttgctcccttctgtcctcagcaaggctcggtcctggaca
ttctag

DBGET integrated database retrieval system