KEGG   Homo sapiens (human): 3587Help
Entry
3587              CDS       T01001                                 

Gene name
IL10RA, CD210, CD210a, CDW210A, HIL-10R, IL-10R1, IL10R
Definition
interleukin 10 receptor, alpha
Orthology
K05134  
interleukin 10 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Toxoplasmosis
Tuberculosis
Epstein-Barr virus infection
Disease
H01227  
Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3587 (IL10RA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3587 (IL10RA)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    3587 (IL10RA)
   05169 Epstein-Barr virus infection
    3587 (IL10RA)
   05145 Toxoplasmosis
    3587 (IL10RA)
Cellular antigens [BR:hsa04090]
 Proteins
  3587 (IL10RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23
AA seq 578 aa AA seqDB search
MLPCLVVLLAALLSLRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVA
LLRYGIESWNSISNCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSV
DEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTF
THKKVKHENFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLTRQYFTVTNVIIFF
AFVLLLSGALAYCLALQLYVRRRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEA
FLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNREPPVLGDSC
SSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGS
ALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRC
LVDEAGLHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWS
FAHDLAPLGCVAAPGGLLGSFNSDLVTLPLISSLQSSE
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgtgcctcgtagtgctgctggcggcgctcctcagcctccgtcttggctcagac
gctcatgggacagagctgcccagccctccgtctgtgtggtttgaagcagaatttttccac
cacatcctccactggacacccatcccaaatcagtctgaaagtacctgctatgaagtggcg
ctcctgaggtatggaatagagtcctggaactccatctccaactgtagccagaccctgtcc
tatgaccttaccgcagtgaccttggacctgtaccacagcaatggctaccgggccagagtg
cgggctgtggacggcagccggcactccaactggaccgtcaccaacacccgcttctctgtg
gatgaagtgactctgacagttggcagtgtgaacctagagatccacaatggcttcatcctc
gggaagattcagctacccaggcccaagatggcccccgcaaatgacacatatgaaagcatc
ttcagtcacttccgagagtatgagattgccattcgcaaggtgccgggaaacttcacgttc
acacacaagaaagtaaaacatgaaaacttcagcctcctaacctctggagaagtgggagag
ttctgtgtccaggtgaaaccatctgtcgcttcccgaagtaacaaggggatgtggtctaaa
gaggagtgcatctccctcaccaggcagtatttcaccgtgaccaacgtcatcatcttcttt
gcctttgtcctgctgctctccggagccctcgcctactgcctggccctccagctgtatgtg
cggcgccgaaagaagctacccagtgtcctgctcttcaagaagcccagccccttcatcttc
atcagccagcgtccctccccagagacccaagacaccatccacccgcttgatgaggaggcc
tttttgaaggtgtccccagagctgaagaacttggacctgcacggcagcacagacagtggc
tttggcagcaccaagccatccctgcagactgaagagccccagttcctcctccctgaccct
cacccccaggctgacagaacgctgggaaacagggagccccctgtgctgggggacagctgc
agtagtggcagcagcaatagcacagacagcgggatctgcctgcaggagcccagcctgagc
cccagcacagggcccacctgggagcaacaggtggggagcaacagcaggggccaggatgac
agtggcattgacttagttcaaaactctgagggccgggctggggacacacagggtggctcg
gccttgggccaccacagtcccccggagcctgaggtgcctggggaagaagacccagctgct
gtggcattccagggttacctgaggcagaccagatgtgctgaagagaaggcaaccaagaca
ggctgcctggaggaagaatcgcccttgacagatggccttggccccaaattcgggagatgc
ctggttgatgaggcaggcttgcatccaccagccctggccaagggctatttgaaacaggat
cctctagaaatgactctggcttcctcaggggccccaacgggacagtggaaccagcccact
gaggaatggtcactcctggccttgagcagctgcagtgacctgggaatatctgactggagc
tttgcccatgaccttgcccctctaggctgtgtggcagccccaggtggtctcctgggcagc
tttaactcagacctggtcaccctgcccctcatctctagcctgcagtcaagtgagtga

DBGET integrated database retrieval system