KEGG   Homo sapiens (human): 3588Help
Entry
3588              CDS       T01001                                 

Gene name
IL10RB, CDW210B, CRF2-4, CRFB4, D21S58, D21S66, IL-10R2
Definition
interleukin 10 receptor, beta
Orthology
K05135  
interleukin 10 receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Toxoplasmosis
Tuberculosis
Epstein-Barr virus infection
Disease
H01227  
Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3588 (IL10RB)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3588 (IL10RB)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    3588 (IL10RB)
   05169 Epstein-Barr virus infection
    3588 (IL10RB)
   05145 Toxoplasmosis
    3588 (IL10RB)
Cellular antigens [BR:hsa04090]
 Proteins
  3588 (IL10RB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
21q22.11
AA seq 325 aa AA seqDB search
MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYR
IFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQV
EVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRN
LEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLG
CFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAE
DSESGKQNPGDSCSLGTPPGQGPQS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggagccttgggagctggctgggtggctgcctgctggtgtcagcattgggaatg
gtaccacctcccgaaaatgtcagaatgaattctgttaatttcaagaacattctacagtgg
gagtcacctgcttttgccaaagggaacctgactttcacagctcagtacctaagttatagg
atattccaagataaatgcatgaatactaccttgacggaatgtgatttctcaagtctttcc
aagtatggtgaccacaccttgagagtcagggctgaatttgcagatgagcattcagactgg
gtaaacatcaccttctgtcctgtggatgacaccattattggaccccctggaatgcaagta
gaagtacttgctgattctttacatatgcgtttcttagcccctaaaattgagaatgaatac
gaaacttggactatgaagaatgtgtataactcatggacttataatgtgcaatactggaaa
aacggtactgatgaaaagtttcaaattactccccagtatgactttgaggtcctcagaaac
ctggagccatggacaacttattgtgttcaagttcgagggtttcttcctgatcggaacaaa
gctggggaatggagtgagcctgtctgtgagcaaacaacccatgacgaaacggtcccctcc
tggatggtggccgtcatcctcatggcctcggtcttcatggtctgcctggcactcctcggc
tgcttcgccttgctgtggtgcgtttacaagaagacaaagtacgccttctcccctaggaat
tctcttccacagcacctgaaagagtttttgggccatcctcatcataacacacttctgttt
ttctcctttccattgtcggatgagaatgatgtttttgacaagctaagtgtcattgcagaa
gactctgagagcggcaagcagaatcctggtgacagctgcagcctcgggaccccgcctggg
caggggccccaaagctag

DBGET integrated database retrieval system