KEGG   Homo sapiens (human): 3589Help
Entry
3589              CDS       T01001                                 

Gene name
IL11, AGIF, IL-11
Definition
interleukin 11
Orthology
K05417  
interleukin 11
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Hematopoietic cell lineage
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3589 (IL11)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3589 (IL11)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3589 (IL11)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    3589 (IL11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.3-q13.4
AA seq 199 aa AA seqDB search
MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQL
RDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLK
TLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGG
LHLTLDWAVRGLLLLKTRL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaactgtgtttgccgcctggtcctggtcgtgctgagcctgtggccagatacagctgtc
gcccctgggccaccacctggcccccctcgagtttccccagaccctcgggccgagctggac
agcaccgtgctcctgacccgctctctcctggcggacacgcggcagctggctgcacagctg
agggacaaattcccagctgacggggaccacaacctggattccctgcccaccctggccatg
agtgcgggggcactgggagctctacagctcccaggtgtgctgacaaggctgcgagcggac
ctactgtcctacctgcggcacgtgcagtggctgcgccgggcaggtggctcttccctgaag
accctggagcccgagctgggcaccctgcaggcccgactggaccggctgctgcgccggctg
cagctcctgatgtcccgcctggccctgccccagccacccccggacccgccggcgcccccg
ctggcgcccccctcctcagcctgggggggcatcagggccgcccacgccatcctggggggg
ctgcacctgacacttgactgggccgtgaggggactgctgctgctgaagactcggctgtga

DBGET integrated database retrieval system