KEGG   Homo sapiens (human): 3589Help
Entry
3589              CDS       T01001                                 

Gene name
IL11, AGIF, IL-11
Definition
(RefSeq) interleukin 11
  KO
K05417  interleukin 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3589 (IL11)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3589 (IL11)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3589 (IL11)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    3589 (IL11)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3589 (IL11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL11
Motif
Other DBs
NCBI-GeneID: 3589
NCBI-ProteinID: NP_000632
OMIM: 147681
HGNC: 5966
Ensembl: ENSG00000095752
Vega: OTTHUMG00000180789
Pharos: P20809(Tbio)
UniProt: P20809 A8K3F7
Structure
PDB: 

Jmol
Position
19q13.42
AA seq 199 aa AA seqDB search
MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQL
RDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLK
TLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGG
LHLTLDWAVRGLLLLKTRL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaactgtgtttgccgcctggtcctggtcgtgctgagcctgtggccagatacagctgtc
gcccctgggccaccacctggcccccctcgagtttccccagaccctcgggccgagctggac
agcaccgtgctcctgacccgctctctcctggcggacacgcggcagctggctgcacagctg
agggacaaattcccagctgacggggaccacaacctggattccctgcccaccctggccatg
agtgcgggggcactgggagctctacagctcccaggtgtgctgacaaggctgcgagcggac
ctactgtcctacctgcggcacgtgcagtggctgcgccgggcaggtggctcttccctgaag
accctggagcccgagctgggcaccctgcaggcccgactggaccggctgctgcgccggctg
cagctcctgatgtcccgcctggccctgccccagccacccccggacccgccggcgcccccg
ctggcgcccccctcctcagcctgggggggcatcagggccgcccacgccatcctggggggg
ctgcacctgacacttgactgggccgtgaggggactgctgctgctgaagactcggctgtga

DBGET integrated database retrieval system