KEGG   Homo sapiens (human): 359Help
Entry
359               CDS       T01001                                 

Gene name
AQP2, AQP-CD, WCH-CD
Definition
aquaporin 2 (collecting duct)
Orthology
K09865  
aquaporin-2
Organism
hsa  Homo sapiens (human)
Pathway
Vasopressin-regulated water reabsorption
Disease
H00252  
Congenital nephrogenic diabetes insipidus (NDI)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    359 (AQP2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   359 (AQP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q12-q13
AA seq 271 aa AA seqDB search
MWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLGIGTLVQALG
HISGAHINPAVTVACLVGCHVSVLRAAFYVAAQLLGAVAGAALLHEITPADIRGDLAVNA
LSNSTTAGQAVTVELFLTLQLVLCIFASTDERRGENPGTPALSIGFSVALGHLLGIHYTG
CSMNPARSLAPAVVTGKFDDHWVFWIGPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGL
EPDTDWEEREVRRRQSVELHSPQSLPRGTKA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtgggagctccgctccatagccttctccagggctgtgttcgcagagttcctggccaca
ctcctcttcgtcttctttggcctcggctctgccctcaactggccacaggccctgccctct
gtgctacagattgccatggcgtttggcttgggtattggcaccctggtacaggctctgggc
cacataagcggggcccacatcaaccctgccgtgactgtggcctgcctggtgggctgccac
gtctccgttctccgagccgccttctacgtggctgcccagctgctgggggctgtggccgga
gccgctctgctccatgagatcacgccagcagacatccgcggggacctggctgtcaatgct
ctcagcaacagcacgacggctggccaggcggtgactgtggagctcttcctgacactgcag
ctggtgctctgcatcttcgcctccaccgatgagcgccgcggagagaacccgggcacccct
gctctctccataggcttctccgtggccctgggccacctccttgggatccattacaccggc
tgctctatgaatcctgcccgctccctggctccagctgtcgtcactggcaaatttgatgac
cactgggtcttctggatcggacccctggtgggcgccatcctgggctccctcctctacaac
tacgtgctgtttccgccagccaagagcctgtcggagcgcctggcagtgctgaagggcctg
gagccggacaccgattgggaggagcgcgaggtgcgacggcggcagtcggtggagctgcac
tcgccgcagagcctgccacggggtaccaaggcctga

DBGET integrated database retrieval system