KEGG   Homo sapiens (human): 3590Help
Entry
3590              CDS       T01001                                 

Gene name
IL11RA, CRSDA
Definition
interleukin 11 receptor, alpha
Orthology
K05056  
interleukin 11 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3590 (IL11RA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3590 (IL11RA)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3590 (IL11RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p13
AA seq 422 aa AA seqDB search
MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWF
RDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSC
QAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARC
VVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASW
TYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLD
AGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHR
DSVEQVAVLASLGILSFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRRPGAP
NL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagctgctcagggctgagcagggtcctggtggccgtggctacagccctggtg
tctgcctcctccccctgcccccaggcctggggccccccaggggtccagtatgggcagcca
ggcaggtccgtgaagctgtgttgtcctggagtgactgccggggacccagtgtcctggttt
cgggatggggagccaaagctgctccagggacctgactctgggctagggcatgaactggtc
ctggcccaggcagacagcactgatgagggcacctacatctgccagaccctggatggtgca
cttgggggcacagtgaccctgcagctgggctaccctccagcccgccctgttgtctcctgc
caagcagccgactatgagaacttctcttgcacttggagtcccagccagatcagcggttta
cccacccgctacctcacctcctacaggaagaagacagtcctaggagctgatagccagagg
aggagtccatccacagggccctggccatgcccacaggatcccctaggggctgcccgctgt
gttgtccacggggctgagttctggagccagtaccggattaatgtgactgaggtgaaccca
ctgggtgccagcacacgcctgctggatgtgagcttgcagagcatcttgcgccctgaccca
ccccagggcctgcgggtagagtcagtaccaggttacccccgacgcctgcgagccagctgg
acataccctgcctcctggccgtgccagccccacttcctgctcaagttccgtttgcagtac
cgtccggcgcagcatccagcctggtccacggtggagccagctggactggaggaggtgatc
acagatgctgtggctgggctgccccatgctgtacgagtcagtgcccgggactttctagat
gctggcacctggagcacctggagcccggaggcctggggaactccgagcactgggaccata
ccaaaggagataccagcatggggccagctacacacgcagccagaggtggagcctcaggtg
gacagccctgctcctccaaggccctccctccaaccacaccctcggctacttgatcacagg
gactctgtggagcaggtagctgtgctggcgtctttgggaatcctttctttcctgggactg
gtggctggggccctggcactggggctctggctgaggctgagacggggtgggaaggatgga
tccccaaagcctgggttcttggcctcagtgattccagtggacaggcgtccaggagctcca
aacctgtag

DBGET integrated database retrieval system