KEGG   Homo sapiens (human): 3594Help
Entry
3594              CDS       T01001                                 

Gene name
IL12RB1, CD212, IL-12R-BETA1, IL12RB
Definition
interleukin 12 receptor, beta 1
Orthology
K05063  
interleukin 12 receptor beta-1
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Inflammatory bowel disease (IBD)
Disease
H00089  
IFN-gamma/IL-12 axis
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.1
AA seq 662 aa AA seqDB search
MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRY
ECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWAR
NQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSP
WKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQ
VRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRT
LHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPA
RAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFA
SAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKE
YVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIE
VQVSDWLIFFASLGSFLSILLVGVLGYLGLNRAARHLCPPLPTPCASSAIEFPGGKETWQ
WINPVDFQEEASLQEALVVEMSWDKGERTEPLEKTELPEGAPELALDTELSLEDGDRCKA
KM
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggagccgctggtgacctgggtggtccccctcctcttcctcttcctgctgtccaggcag
ggcgctgcctgcagaaccagtgagtgctgttttcaggacccgccatatccggatgcagac
tcaggctcggcctcgggccctagggacctgagatgctatcggatatccagtgatcgttac
gagtgctcctggcagtatgagggtcccacagctggggtcagccacttcctgcggtgttgc
cttagctccgggcgctgctgctacttcgccgccggctcagccaccaggctgcagttctcc
gaccaggctggggtgtctgtgctgtacactgtcacactctgggtggaatcctgggccagg
aaccagacagagaagtctcctgaggtgaccctgcagctctacaactcagttaaatatgag
cctcctctgggagacatcaaggtgtccaagttggccgggcagctgcgtatggagtgggag
accccggataaccaggttggtgctgaggtgcagttccggcaccggacacccagcagccca
tggaagttgggcgactgcggacctcaggatgatgatactgagtcctgcctctgccccctg
gagatgaatgtggcccaggaattccagctccgacgacggcagctggggagccaaggaagt
tcctggagcaagtggagcagccccgtgtgcgttccccctgaaaaccccccacagcctcag
gtgagattctcggtggagcagctgggccaggatgggaggaggcggctgaccctgaaagag
cagccaacccagctggagcttccagaaggctgtcaagggctggcgcctggcacggaggtc
acttaccgactacagctccacatgctgtcctgcccgtgtaaggccaaggccaccaggacc
ctgcacctggggaagatgccctatctctcgggtgctgcctacaacgtggctgtcatctcc
tcgaaccaatttggtcctggcctgaaccagacgtggcacattcctgccgacacccacaca
gaaccagtggctctgaatatcagcgtcggaaccaacgggaccaccatgtattggccagcc
cgggctcagagcatgacgtattgcattgaatggcagcctgtgggccaggacgggggcctt
gccacctgcagcctgactgcgccgcaagacccggatccggctggaatggcaacctacagc
tggagtcgagagtctggggcaatggggcaggaaaagtgttactacattaccatctttgcc
tctgcgcaccccgagaagctcaccttgtggtctacggtcctgtccacctaccactttggg
ggcaatgcctcagcagctgggacaccgcaccacgtctcggtgaagaatcatagcttggac
tctgtgtctgtggactgggcaccatccctgctgagcacctgtcccggcgtcctaaaggag
tatgttgtccgctgccgagatgaagacagcaaacaggtgtcagagcatcccgtgcagccc
acagagacccaagttaccctcagtggcctgcgggctggtgtagcctacacggtgcaggtg
cgagcagacacagcgtggctgaggggtgtctggagccagccccagcgcttcagcatcgaa
gtgcaggtttctgattggctcatcttcttcgcctccctggggagcttcctgagcatcctt
ctcgtgggcgtccttggctaccttggcctgaacagggccgcacggcacctgtgcccgccg
ctgcccacaccctgtgccagctccgccattgagttccctggagggaaggagacttggcag
tggatcaacccagtggacttccaggaagaggcatccctgcaggaggccctggtggtagag
atgtcctgggacaaaggcgagaggactgagcctctcgagaagacagagctacctgagggt
gcccctgagctggccctggatacagagttgtccttggaggatggagacaggtgcaaggcc
aagatgtga

DBGET integrated database retrieval system