KEGG   Homo sapiens (human): 3594Help
Entry
3594              CDS       T01001                                 

Gene name
IL12RB1, CD212, IL-12R-BETA1, IL12RB, IMD30
Definition
(RefSeq) interleukin 12 receptor subunit beta 1
  KO
K05063  
interleukin 12 receptor beta-1
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
Inflammatory bowel disease (IBD)
Disease
H00089  
IFN-gamma/IL-12 axis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3594 (IL12RB1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3594 (IL12RB1)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    3594 (IL12RB1)
   04659 Th17 cell differentiation
    3594 (IL12RB1)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    3594 (IL12RB1)
Cytokine receptors [BR:hsa04050]
 Class I cytokine receptor (hematopoietin family receptor)
  3594 (IL12RB1)
Cellular antigens [BR:hsa04090]
 Proteins
  3594 (IL12RB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P42701(Tbio)
UniProt: 
Position
19p13.11
AA seq 662 aa AA seqDB search
MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRY
ECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWAR
NQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSP
WKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQ
VRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRT
LHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPA
RAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFA
SAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKE
YVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIE
VQVSDWLIFFASLGSFLSILLVGVLGYLGLNRAARHLCPPLPTPCASSAIEFPGGKETWQ
WINPVDFQEEASLQEALVVEMSWDKGERTEPLEKTELPEGAPELALDTELSLEDGDRCKA
KM
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggagccgctggtgacctgggtggtccccctcctcttcctcttcctgctgtccaggcag
ggcgctgcctgcagaaccagtgagtgctgttttcaggacccgccatatccggatgcagac
tcaggctcggcctcgggccctagggacctgagatgctatcggatatccagtgatcgttac
gagtgctcctggcagtatgagggtcccacagctggggtcagccacttcctgcggtgttgc
cttagctccgggcgctgctgctacttcgccgccggctcagccaccaggctgcagttctcc
gaccaggctggggtgtctgtgctgtacactgtcacactctgggtggaatcctgggccagg
aaccagacagagaagtctcctgaggtgaccctgcagctctacaactcagttaaatatgag
cctcctctgggagacatcaaggtgtccaagttggccgggcagctgcgtatggagtgggag
accccggataaccaggttggtgctgaggtgcagttccggcaccggacacccagcagccca
tggaagttgggcgactgcggacctcaggatgatgatactgagtcctgcctctgccccctg
gagatgaatgtggcccaggaattccagctccgacgacggcagctggggagccaaggaagt
tcctggagcaagtggagcagccccgtgtgcgttccccctgaaaaccccccacagcctcag
gtgagattctcggtggagcagctgggccaggatgggaggaggcggctgaccctgaaagag
cagccaacccagctggagcttccagaaggctgtcaagggctggcgcctggcacggaggtc
acttaccgactacagctccacatgctgtcctgcccgtgtaaggccaaggccaccaggacc
ctgcacctggggaagatgccctatctctcgggtgctgcctacaacgtggctgtcatctcc
tcgaaccaatttggtcctggcctgaaccagacgtggcacattcctgccgacacccacaca
gaaccagtggctctgaatatcagcgtcggaaccaacgggaccaccatgtattggccagcc
cgggctcagagcatgacgtattgcattgaatggcagcctgtgggccaggacgggggcctt
gccacctgcagcctgactgcgccgcaagacccggatccggctggaatggcaacctacagc
tggagtcgagagtctggggcaatggggcaggaaaagtgttactacattaccatctttgcc
tctgcgcaccccgagaagctcaccttgtggtctacggtcctgtccacctaccactttggg
ggcaatgcctcagcagctgggacaccgcaccacgtctcggtgaagaatcatagcttggac
tctgtgtctgtggactgggcaccatccctgctgagcacctgtcccggcgtcctaaaggag
tatgttgtccgctgccgagatgaagacagcaaacaggtgtcagagcatcccgtgcagccc
acagagacccaagttaccctcagtggcctgcgggctggtgtagcctacacggtgcaggtg
cgagcagacacagcgtggctgaggggtgtctggagccagccccagcgcttcagcatcgaa
gtgcaggtttctgattggctcatcttcttcgcctccctggggagcttcctgagcatcctt
ctcgtgggcgtccttggctaccttggcctgaacagggccgcacggcacctgtgcccgccg
ctgcccacaccctgtgccagctccgccattgagttccctggagggaaggagacttggcag
tggatcaacccagtggacttccaggaagaggcatccctgcaggaggccctggtggtagag
atgtcctgggacaaaggcgagaggactgagcctctcgagaagacagagctacctgagggt
gcccctgagctggccctggatacagagttgtccttggaggatggagacaggtgcaaggcc
aagatgtga

DBGET integrated database retrieval system