KEGG   Homo sapiens (human): 3595Help
Entry
3595              CDS       T01001                                 

Gene name
IL12RB2
Definition
(RefSeq) interleukin 12 receptor subunit beta 2
  KO
K05064  
interleukin 12 receptor beta-2
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Inflammatory bowel disease (IBD)
Disease
H01476  
Behcet Disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3595 (IL12RB2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3595 (IL12RB2)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    3595 (IL12RB2)
Cytokine receptors [BR:hsa04050]
 Class I cytokine receptor (hematopoietin family receptor)
  3595 (IL12RB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p31.3-p31.2
AA seq 862 aa AA seqDB search
MAHTFRGCSLAFMFIITWLLIKAKIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCF
HYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFV
GVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDY
LDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVS
RCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHL
YKGSWSDWSESLRAQTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHY
QVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAG
LLAPRQVSANSEGMDNILVTWQPPRKDPSAVQEYVVEWRELHPGGDTQVPLNWLRSRPYN
VSALISENIKSYICYEIRVYALSGDQGGCSSILGNSKHKAPLSGPHINAITEEKGSILIS
WNSIPVQEQMGCLLHYRIYWKERDSNSQPQLCEIPYRVSQNSHPINSLQPRVTYVLWMTA
LTAAGESSHGNEREFCLQGKANWMAFVAPSICIAIIMVGIFSTHYFQQKVFVLLAALRPQ
WCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPLVISEVLHQVTPVFRH
PPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESRGSDPKPE
NPACPWTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPL
TFSCGDKLTLDQLKMRCDSLML
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atggcacatacttttagaggatgctcattggcatttatgtttataatcacgtggctgttg
attaaagcaaaaatagatgcgtgcaagagaggcgatgtgactgtgaagccttcccatgta
attttacttggatccactgtcaatattacatgctctttgaagcccagacaaggctgcttt
cactattccagacgtaacaagttaatcctgtacaagtttgacagaagaatcaattttcac
catggccactccctcaattctcaagtcacaggtcttccccttggtacaaccttgtttgtc
tgcaaactggcctgtatcaatagtgatgaaattcaaatatgtggagcagagatcttcgtt
ggtgttgctccagaacagcctcaaaatttatcctgcatacagaagggagaacaggggact
gtggcctgcacctgggaaagaggacgagacacccacttatacactgagtatactctacag
ctaagtggaccaaaaaatttaacctggcagaagcaatgtaaagacatttattgtgactat
ttggactttggaatcaacctcacccctgaatcacctgaatccaatttcacagccaaggtt
actgctgtcaatagtcttggaagctcctcttcacttccatccacattcacattcttggac
atagtgaggcctcttcctccgtgggacattagaatcaaatttcaaaaggcttctgtgagc
agatgtaccctttattggagagatgagggactggtactgcttaatcgactcagatatcgg
cccagtaacagcaggctctggaatatggttaatgttacaaaggccaaaggaagacatgat
ttgctggatctgaaaccatttacagaatatgaatttcagatttcctctaagctacatctt
tataagggaagttggagtgattggagtgaatcattgagagcacaaacaccagaagaagag
cctactgggatgttagatgtctggtacatgaaacggcacattgactacagtagacaacag
atttctcttttctggaagaatctgagtgtctcagaggcaagaggaaaaattctccactat
caggtgaccttgcaggagctgacaggagggaaagccatgacacagaacatcacaggacac
acctcctggaccacagtcattcctagaaccggaaattgggctgtggctgtgtctgcagca
aattcaaaaggcagttctctgcccactcgtattaacataatgaacctgtgtgaggcaggg
ttgctggctcctcgccaggtctctgcaaactcagagggcatggacaacattctggtgact
tggcagcctcccaggaaagatccctctgctgttcaggagtacgtggtggaatggagagag
ctccatccagggggtgacacacaggtccctctaaactggctacggagtcgaccctacaat
gtgtctgctctgatttcagagaacataaaatcctacatctgttatgaaatccgtgtgtat
gcactctcaggggatcaaggaggatgcagctccatcctgggtaactctaagcacaaagca
ccactgagtggcccccacattaatgccatcacagaggaaaaggggagcattttaatttca
tggaacagcattccagtccaggagcaaatgggctgcctcctccattataggatatactgg
aaggaacgggactccaactcccagcctcagctctgtgaaattccctacagagtctcccaa
aattcacatccaataaacagcctgcagccccgagtgacatatgtcctgtggatgacagct
ctgacagctgctggtgaaagttcccacggaaatgagagggaattttgtctgcaaggtaaa
gccaattggatggcgtttgtggcaccaagcatttgcattgctatcatcatggtgggcatt
ttctcaacgcattacttccagcaaaaggtgtttgttctcctagcagccctcagacctcag
tggtgtagcagagaaattccagatccagcaaatagcacttgcgctaagaaatatcccatt
gcagaggagaagacacagctgcccttggacaggctcctgatagactggcccacgcctgaa
gatcctgaaccgctggtcatcagtgaagtccttcatcaagtgaccccagttttcagacat
cccccctgctccaactggccacaaagggaaaaaggaatccaaggtcatcaggcctctgag
aaagacatgatgcacagtgcctcaagcccaccacctccaagagctctccaagctgagagc
agacaactggtggatctgtacaaggtgctggagagcaggggctccgacccaaagcccgaa
aacccagcctgtccctggacggtgctcccagcaggtgaccttcccacccatgatggctac
ttaccctccaacatagatgacctcccctcacatgaggcacctctcgctgactctctggaa
gaactggagcctcagcacatctccctttctgttttcccctcaagttctcttcacccactc
accttctcctgtggtgataagctgactctggatcagttaaagatgaggtgtgactccctc
atgctctga

DBGET integrated database retrieval system