KEGG   Homo sapiens (human): 3595Help
Entry
3595              CDS       T01001                                 

Gene name
IL12RB2
Definition
(RefSeq) interleukin 12 receptor subunit beta 2
  KO
K05064  interleukin 12 receptor beta-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease (IBD)
Network
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H01476  Behcet disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3595 (IL12RB2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3595 (IL12RB2)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    3595 (IL12RB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3595 (IL12RB2)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    3595 (IL12RB2)
Cytokine receptors [BR:hsa04050]
 Class I cytokine receptor (hematopoietin family receptor)
  3595 (IL12RB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind Tissue_fac EpoR_lig-bind
Motif
Other DBs
NCBI-GeneID: 3595
NCBI-ProteinID: NP_001550
OMIM: 601642
HGNC: 5972
Ensembl: ENSG00000081985
Vega: OTTHUMG00000009094
Pharos: Q99665(Tbio)
UniProt: Q99665
Position
1p31.3
AA seq 862 aa AA seqDB search
MAHTFRGCSLAFMFIITWLLIKAKIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCF
HYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFV
GVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDY
LDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVS
RCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHL
YKGSWSDWSESLRAQTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHY
QVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAG
LLAPRQVSANSEGMDNILVTWQPPRKDPSAVQEYVVEWRELHPGGDTQVPLNWLRSRPYN
VSALISENIKSYICYEIRVYALSGDQGGCSSILGNSKHKAPLSGPHINAITEEKGSILIS
WNSIPVQEQMGCLLHYRIYWKERDSNSQPQLCEIPYRVSQNSHPINSLQPRVTYVLWMTA
LTAAGESSHGNEREFCLQGKANWMAFVAPSICIAIIMVGIFSTHYFQQKVFVLLAALRPQ
WCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPLVISEVLHQVTPVFRH
PPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESRGSDPKPE
NPACPWTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPL
TFSCGDKLTLDQLKMRCDSLML
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atggcacatacttttagaggatgctcattggcatttatgtttataatcacgtggctgttg
attaaagcaaaaatagatgcgtgcaagagaggcgatgtgactgtgaagccttcccatgta
attttacttggatccactgtcaatattacatgctctttgaagcccagacaaggctgcttt
cactattccagacgtaacaagttaatcctgtacaagtttgacagaagaatcaattttcac
catggccactccctcaattctcaagtcacaggtcttccccttggtacaaccttgtttgtc
tgcaaactggcctgtatcaatagtgatgaaattcaaatatgtggagcagagatcttcgtt
ggtgttgctccagaacagcctcaaaatttatcctgcatacagaagggagaacaggggact
gtggcctgcacctgggaaagaggacgagacacccacttatacactgagtatactctacag
ctaagtggaccaaaaaatttaacctggcagaagcaatgtaaagacatttattgtgactat
ttggactttggaatcaacctcacccctgaatcacctgaatccaatttcacagccaaggtt
actgctgtcaatagtcttggaagctcctcttcacttccatccacattcacattcttggac
atagtgaggcctcttcctccgtgggacattagaatcaaatttcaaaaggcttctgtgagc
agatgtaccctttattggagagatgagggactggtactgcttaatcgactcagatatcgg
cccagtaacagcaggctctggaatatggttaatgttacaaaggccaaaggaagacatgat
ttgctggatctgaaaccatttacagaatatgaatttcagatttcctctaagctacatctt
tataagggaagttggagtgattggagtgaatcattgagagcacaaacaccagaagaagag
cctactgggatgttagatgtctggtacatgaaacggcacattgactacagtagacaacag
atttctcttttctggaagaatctgagtgtctcagaggcaagaggaaaaattctccactat
caggtgaccttgcaggagctgacaggagggaaagccatgacacagaacatcacaggacac
acctcctggaccacagtcattcctagaaccggaaattgggctgtggctgtgtctgcagca
aattcaaaaggcagttctctgcccactcgtattaacataatgaacctgtgtgaggcaggg
ttgctggctcctcgccaggtctctgcaaactcagagggcatggacaacattctggtgact
tggcagcctcccaggaaagatccctctgctgttcaggagtacgtggtggaatggagagag
ctccatccagggggtgacacacaggtccctctaaactggctacggagtcgaccctacaat
gtgtctgctctgatttcagagaacataaaatcctacatctgttatgaaatccgtgtgtat
gcactctcaggggatcaaggaggatgcagctccatcctgggtaactctaagcacaaagca
ccactgagtggcccccacattaatgccatcacagaggaaaaggggagcattttaatttca
tggaacagcattccagtccaggagcaaatgggctgcctcctccattataggatatactgg
aaggaacgggactccaactcccagcctcagctctgtgaaattccctacagagtctcccaa
aattcacatccaataaacagcctgcagccccgagtgacatatgtcctgtggatgacagct
ctgacagctgctggtgaaagttcccacggaaatgagagggaattttgtctgcaaggtaaa
gccaattggatggcgtttgtggcaccaagcatttgcattgctatcatcatggtgggcatt
ttctcaacgcattacttccagcaaaaggtgtttgttctcctagcagccctcagacctcag
tggtgtagcagagaaattccagatccagcaaatagcacttgcgctaagaaatatcccatt
gcagaggagaagacacagctgcccttggacaggctcctgatagactggcccacgcctgaa
gatcctgaaccgctggtcatcagtgaagtccttcatcaagtgaccccagttttcagacat
cccccctgctccaactggccacaaagggaaaaaggaatccaaggtcatcaggcctctgag
aaagacatgatgcacagtgcctcaagcccaccacctccaagagctctccaagctgagagc
agacaactggtggatctgtacaaggtgctggagagcaggggctccgacccaaagcccgaa
aacccagcctgtccctggacggtgctcccagcaggtgaccttcccacccatgatggctac
ttaccctccaacatagatgacctcccctcacatgaggcacctctcgctgactctctggaa
gaactggagcctcagcacatctccctttctgttttcccctcaagttctcttcacccactc
accttctcctgtggtgataagctgactctggatcagttaaagatgaggtgtgactccctc
atgctctga

DBGET integrated database retrieval system