KEGG   Homo sapiens (human): 3597Help
Entry
3597              CDS       T01001                                 

Gene name
IL13RA1, CD213A1, IL-13Ra, NR4
Definition
interleukin 13 receptor, alpha 1
Orthology
K05076  
interleukin 13 receptor alpha-1
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq24
AA seq 427 aa AA seqDB search
MEWPARLCGLWALLLCAGGGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASS
NCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISP
PEGDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIFREG
QYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHN
DDLYVQWENPQNFISRCLFYEVEVNNSQTETHNVFYVQEAKCENPEFERNVENTSCFMVP
GVLPDTLNTVRIRVKTNKLCYEDDKLWSNWSQEMSIGKKRNSTLYITMLLIVPVIVAGAI
IVLLLYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQTKEETDSVVLIE
NLKKASQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggagtggccggcgcggctctgcgggctgtgggcgctgctgctctgcgccggcggcggg
ggcgggggcgggggcgccgcgcctacggaaactcagccacctgtgacaaatttgagtgtc
tctgttgaaaacctctgcacagtaatatggacatggaatccacccgagggagccagctca
aattgtagtctatggtattttagtcattttggcgacaaacaagataagaaaatagctccg
gaaactcgtcgttcaatagaagtacccctgaatgagaggatttgtctgcaagtggggtcc
cagtgtagcaccaatgagagtgagaagcctagcattttggttgaaaaatgcatctcaccc
ccagaaggtgatcctgagtctgctgtgactgagcttcaatgcatttggcacaacctgagc
tacatgaagtgttcttggctccctggaaggaataccagtcccgacactaactatactctc
tactattggcacagaagcctggaaaaaattcatcaatgtgaaaacatctttagagaaggc
caatactttggttgttcctttgatctgaccaaagtgaaggattccagttttgaacaacac
agtgtccaaataatggtcaaggataatgcaggaaaaattaaaccatccttcaatatagtg
cctttaacttcccgtgtgaaacctgatcctccacatattaaaaacctctccttccacaat
gatgacctatatgtgcaatgggagaatccacagaattttattagcagatgcctattttat
gaagtagaagtcaataacagccaaactgagacacataatgttttctacgtccaagaggct
aaatgtgagaatccagaatttgagagaaatgtggagaatacatcttgtttcatggtccct
ggtgttcttcctgatactttgaacacagtcagaataagagtcaaaacaaataagttatgc
tatgaggatgacaaactctggagtaattggagccaagaaatgagtataggtaagaagcgc
aattccacactctacataaccatgttactcattgttccagtcatcgtcgcaggtgcaatc
atagtactcctgctttacctaaaaaggctcaagattattatattccctccaattcctgat
cctggcaagatttttaaagaaatgtttggagaccagaatgatgatactctgcactggaag
aagtacgacatctatgagaagcaaaccaaggaggaaaccgactctgtagtgctgatagaa
aacctgaagaaagcctctcagtga

DBGET integrated database retrieval system