KEGG   Homo sapiens (human): 3598Help
Entry
3598              CDS       T01001                                 

Gene name
IL13RA2, CD213A2, CT19, IL-13R, IL13BP
Definition
(RefSeq) interleukin 13 receptor subunit alpha 2
  KO
K05077  interleukin 13 receptor alpha-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3598 (IL13RA2)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL3 receptor family
   3598 (IL13RA2)
CD molecules [BR:hsa04090]
 Proteins
  3598 (IL13RA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind
Motif
Other DBs
NCBI-GeneID: 3598
NCBI-ProteinID: NP_000631
OMIM: 300130
HGNC: 5975
Ensembl: ENSG00000123496
Vega: OTTHUMG00000022229
Pharos: Q14627(Tbio)
UniProt: Q14627
Structure
PDB: 

Jmol
Position
Xq23
AA seq 380 aa AA seqDB search
MAFVCLAIGCLYTFLISTTFGCTSSSDTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLD
HFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQ
SSWAETTYWISPQGIPETKVQDMDCVYYNWQYLLCSWKPGIGVLLDTNYNLFYWYEGLDH
ALQCVDYIKADGQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLP
PVYLTFTRESSCEIKLKWSIPLGPIPARCFDYEIEIREDDTTLVTATVENETYTLKTTNE
TRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEGEDLSKKTLLRFWLPFGFILILVIFVTG
LLLRKPNTYPKMIPEFFCDT
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgtttgcttggctatcggatgcttatatacctttctgataagcacaacattt
ggctgtacttcatcttcagacaccgagataaaagttaaccctcctcaggattttgagata
gtggatcccggatacttaggttatctctatttgcaatggcaacccccactgtctctggat
cattttaaggaatgcacagtggaatatgaactaaaataccgaaacattggtagtgaaaca
tggaagaccatcattactaagaatctacattacaaagatgggtttgatcttaacaagggc
attgaagcgaagatacacacgcttttaccatggcaatgcacaaatggatcagaagttcaa
agttcctgggcagaaactacttattggatatcaccacaaggaattccagaaactaaagtt
caggatatggattgcgtatattacaattggcaatatttactctgttcttggaaacctggc
ataggtgtacttcttgataccaattacaacttgttttactggtatgagggcttggatcat
gcattacagtgtgttgattacatcaaggctgatggacaaaatataggatgcagatttccc
tatttggaggcatcagactataaagatttctatatttgtgttaatggatcatcagagaac
aagcctatcagatccagttatttcacttttcagcttcaaaatatagttaaacctttgccg
ccagtctatcttacttttactcgggagagttcatgtgaaattaagctgaaatggagcata
cctttgggacctattccagcaaggtgttttgattatgaaattgagatcagagaagatgat
actaccttggtgactgctacagttgaaaatgaaacatacaccttgaaaacaacaaatgaa
acccgacaattatgctttgtagtaagaagcaaagtgaatatttattgctcagatgacgga
atttggagtgagtggagtgataaacaatgctgggaaggtgaagacctatcgaagaaaact
ttgctacgtttctggctaccatttggtttcatcttaatattagttatatttgtaaccggt
ctgcttttgcgtaagccaaacacctacccaaaaatgattccagaatttttctgtgataca
tga

DBGET integrated database retrieval system