KEGG   Homo sapiens (human): 3598Help
Entry
3598              CDS       T01001                                 

Gene name
IL13RA2, CD213A2, CT19, IL-13R, IL13BP
Definition
interleukin 13 receptor, alpha 2
Orthology
K05077  
interleukin 13 receptor alpha-2
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq23
AA seq 380 aa AA seqDB search
MAFVCLAIGCLYTFLISTTFGCTSSSDTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLD
HFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQ
SSWAETTYWISPQGIPETKVQDMDCVYYNWQYLLCSWKPGIGVLLDTNYNLFYWYEGLDH
ALQCVDYIKADGQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLP
PVYLTFTRESSCEIKLKWSIPLGPIPARCFDYEIEIREDDTTLVTATVENETYTLKTTNE
TRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEGEDLSKKTLLRFWLPFGFILILVIFVTG
LLLRKPNTYPKMIPEFFCDT
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgtttgcttggctatcggatgcttatatacctttctgataagcacaacattt
ggctgtacttcatcttcagacaccgagataaaagttaaccctcctcaggattttgagata
gtggatcccggatacttaggttatctctatttgcaatggcaacccccactgtctctggat
cattttaaggaatgcacagtggaatatgaactaaaataccgaaacattggtagtgaaaca
tggaagaccatcattactaagaatctacattacaaagatgggtttgatcttaacaagggc
attgaagcgaagatacacacgcttttaccatggcaatgcacaaatggatcagaagttcaa
agttcctgggcagaaactacttattggatatcaccacaaggaattccagaaactaaagtt
caggatatggattgcgtatattacaattggcaatatttactctgttcttggaaacctggc
ataggtgtacttcttgataccaattacaacttgttttactggtatgagggcttggatcat
gcattacagtgtgttgattacatcaaggctgatggacaaaatataggatgcagatttccc
tatttggaggcatcagactataaagatttctatatttgtgttaatggatcatcagagaac
aagcctatcagatccagttatttcacttttcagcttcaaaatatagttaaacctttgccg
ccagtctatcttacttttactcgggagagttcatgtgaaattaagctgaaatggagcata
cctttgggacctattccagcaaggtgttttgattatgaaattgagatcagagaagatgat
actaccttggtgactgctacagttgaaaatgaaacatacaccttgaaaacaacaaatgaa
acccgacaattatgctttgtagtaagaagcaaagtgaatatttattgctcagatgacgga
atttggagtgagtggagtgataaacaatgctgggaaggtgaagacctatcgaagaaaact
ttgctacgtttctggctaccatttggtttcatcttaatattagttatatttgtaaccggt
ctgcttttgcgtaagccaaacacctacccaaaaatgattccagaatttttctgtgataca
tga

DBGET integrated database retrieval system