KEGG   Homo sapiens (human): 3601Help
Entry
3601              CDS       T01001                                 

Gene name
IL15RA, CD215
Definition
interleukin 15 receptor, alpha
Orthology
K05074  
interleukin 15 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Intestinal immune network for IgA production
HTLV-I infection
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:hsa04672]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10p15.1
AA seq 231 aa AA seqDB search
MSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD
PALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSK
SPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLC
GLSAVSLLACYLKSRQTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtggaacacgcagacatctgggtcaagagctacagcttgtactccagggagcgg
tacatttgtaactctggtttcaagcgtaaagccggcacgtccagcctgacggagtgcgtg
ttgaacaaggccacgaatgtcgcccactggacaacccccagtctcaaatgcattagagac
cctgccctggttcaccaaaggccagcgccaccctccacagtaacgacggcaggggtgacc
ccacagccagagagcctctccccttctggaaaagagcccgcagcttcatctcccagctca
aacaacacagcggccacaacagcagctattgtcccgggctcccagctgatgccttcaaaa
tcaccttccacaggaaccacagagataagcagtcatgagtcctcccacggcaccccctct
cagacaacagccaagaactgggaactcacagcatccgcctcccaccagccgccaggtgtg
tatccacagggccacagcgacaccactgtggctatctccacgtccactgtcctgctgtgt
gggctgagcgctgtgtctctcctggcatgctacctcaagtcaaggcaaactcccccgctg
gccagcgttgaaatggaagccatggaggctctgccggtgacttgggggaccagcagcaga
gatgaagacttggaaaactgctctcaccacctatga

DBGET integrated database retrieval system