KEGG   Homo sapiens (human): 3601Help
Entry
3601              CDS       T01001                                 

Gene name
IL15RA, CD215
Definition
(RefSeq) interleukin 15 receptor subunit alpha
  KO
K05074  interleukin 15 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05166  HTLV-I infection
hsa05200  Pathways in cancer
Network
N00053  Cytokine-Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3601 (IL15RA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3601 (IL15RA)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    3601 (IL15RA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3601 (IL15RA)
  Infectious diseases
   05166 HTLV-I infection
    3601 (IL15RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3601 (IL15RA)
CD molecules [BR:hsa04090]
 Proteins
  3601 (IL15RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi
Motif
Other DBs
NCBI-GeneID: 3601
NCBI-ProteinID: NP_002180
OMIM: 601070
HGNC: 5978
Ensembl: ENSG00000134470
Vega: OTTHUMG00000017612
Pharos: Q13261(Tbio)
UniProt: Q13261
Structure
PDB: 

Jmol
Position
10p15.1
AA seq 267 aa AA seqDB search
MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICN
SGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPE
SLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTA
KNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVE
MEAMEALPVTWGTSSRDEDLENCSHHL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcggcgggcgcgcggctgccggaccctcggtctcccggcgctgctactgctg
ctgctgctccggccgccggcgacgcggggcatcacgtgccctccccccatgtccgtggaa
cacgcagacatctgggtcaagagctacagcttgtactccagggagcggtacatttgtaac
tctggtttcaagcgtaaagccggcacgtccagcctgacggagtgcgtgttgaacaaggcc
acgaatgtcgcccactggacaacccccagtctcaaatgcattagagaccctgccctggtt
caccaaaggccagcgccaccctccacagtaacgacggcaggggtgaccccacagccagag
agcctctccccttctggaaaagagcccgcagcttcatctcccagctcaaacaacacagcg
gccacaacagcagctattgtcccgggctcccagctgatgccttcaaaatcaccttccaca
ggaaccacagagataagcagtcatgagtcctcccacggcaccccctctcagacaacagcc
aagaactgggaactcacagcatccgcctcccaccagccgccaggtgtgtatccacagggc
cacagcgacaccactgtggctatctccacgtccactgtcctgctgtgtgggctgagcgct
gtgtctctcctggcatgctacctcaagtcaaggcaaactcccccgctggccagcgttgaa
atggaagccatggaggctctgccggtgacttgggggaccagcagcagagatgaagacttg
gaaaactgctctcaccacctatga

DBGET integrated database retrieval system