KEGG   Homo sapiens (human): 3604Help
Entry
3604              CDS       T01001                                 

Gene name
TNFRSF9, 4-1BB, CD137, CDw137, ILA
Definition
tumor necrosis factor receptor superfamily, member 9
Orthology
K05146  
tumor necrosis factor receptor superfamily member 9
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3604 (TNFRSF9)
Cellular antigens [BR:hsa04090]
 Proteins
  3604 (TNFRSF9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
1p36
AA seq 255 aa AA seqDB search
MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQR
TCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDC
CFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPARE
PGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDG
CSCRFPEEEEGGCEL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacagctgttacaacatagtagccactctgttgctggtcctcaactttgagagg
acaagatcattgcaggatccttgtagtaactgcccagctggtacattctgtgataataac
aggaatcagatttgcagtccctgtcctccaaatagtttctccagcgcaggtggacaaagg
acctgtgacatatgcaggcagtgtaaaggtgttttcaggaccaggaaggagtgttcctcc
accagcaatgcagagtgtgactgcactccagggtttcactgcctgggggcaggatgcagc
atgtgtgaacaggattgtaaacaaggtcaagaactgacaaaaaaaggttgtaaagactgt
tgctttgggacatttaacgatcagaaacgtggcatctgtcgaccctggacaaactgttct
ttggatggaaagtctgtgcttgtgaatgggacgaaggagagggacgtggtctgtggacca
tctccagccgacctctctccgggagcatcctctgtgaccccgcctgcccctgcgagagag
ccaggacactctccgcagatcatctccttctttcttgcgctgacgtcgactgcgttgctc
ttcctgctgttcttcctcacgctccgtttctctgttgttaaacggggcagaaagaaactc
ctgtatatattcaaacaaccatttatgagaccagtacaaactactcaagaggaagatggc
tgtagctgccgatttccagaagaagaagaaggaggatgtgaactgtga

DBGET integrated database retrieval system