KEGG   Homo sapiens (human): 3605Help
Entry
3605              CDS       T01001                                 

Gene name
IL17A, CTLA8, IL-17, IL-17A, IL17
Definition
interleukin 17A
Orthology
K05489  
interleukin 17
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Drug target
Secukinumab: 
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p12
AA seq 155 aa AA seqDB search
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNP
KRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEIL
VLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgactcctgggaagacctcattggtgtcactgctactgctgctgagcctggaggccata
gtgaaggcaggaatcacaatcccacgaaatccaggatgcccaaattctgaggacaagaac
ttcccccggactgtgatggtcaacctgaacatccataaccggaataccaataccaatccc
aaaaggtcctcagattactacaaccgatccacctcaccttggaatctccaccgcaatgag
gaccctgagagatatccctctgtgatctgggaggcaaagtgccgccacttgggctgcatc
aacgctgatgggaacgtggactaccacatgaactctgtccccatccagcaagagatcctg
gtcctgcgcagggagcctccacactgccccaactccttccggctggagaagatactggtg
tccgtgggctgcacctgtgtcaccccgattgtccaccatgtggcctaa

DBGET integrated database retrieval system