KEGG   Homo sapiens (human): 3606Help
Entry
3606              CDS       T01001                                 

Gene name
IL18, IGIF, IL-18, IL-1g, IL1F4
Definition
interleukin 18
Orthology
K05482  
interleukin 18
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Salmonella infection
Legionellosis
African trypanosomiasis
Malaria
Tuberculosis
Influenza A
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Disease
H01360  
Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3606 (IL18)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    3606 (IL18)
   04623 Cytosolic DNA-sensing pathway
    3606 (IL18)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    3606 (IL18)
   05321 Inflammatiory bowel disease (IBD)
    3606 (IL18)
  Infectious diseases
   05132 Salmonella infection
    3606 (IL18)
   05134 Legionellosis
    3606 (IL18)
   05152 Tuberculosis
    3606 (IL18)
   05164 Influenza A
    3606 (IL18)
   05144 Malaria
    3606 (IL18)
   05143 African trypanosomiasis
    3606 (IL18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q22.2-q22.3
AA seq 189 aa AA seqDB search
MAAEPVEDNCINFVAMKFIDNTLYFIENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRP
LFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNP
PDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRS
IMFTVQNED
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgaaccagtagaagacaattgcatcaactttgtggcaatgaaatttattgac
aatacgctttactttatagaaaacctggaatcagattactttggcaagcttgaatctaaa
ttatcagtcataagaaatttgaatgaccaagttctcttcattgaccaaggaaatcggcct
ctatttgaagatatgactgattctgactgtagagataatgcaccccggaccatatttatt
ataagtatgtataaagatagccagcctagaggtatggctgtaactatctctgtgaagtgt
gagaaaatttcaactctctcctgtgagaacaaaattatttcctttaaggaaatgaatcct
cctgataacatcaaggatacaaaaagtgacatcatattctttcagagaagtgtcccagga
catgataataagatgcaatttgaatcttcatcatacgaaggatactttctagcttgtgaa
aaagagagagacctttttaaactcattttgaaaaaagaggatgaattgggggatagatct
ataatgttcactgttcaaaacgaagactag

DBGET integrated database retrieval system