KEGG   Homo sapiens (human): 361Help
Entry
361               CDS       T01001                                 

Gene name
AQP4, HMIWC2, MIWC
Definition
aquaporin 4
Orthology
K09866  
aquaporin-4
Organism
hsa  Homo sapiens (human)
Pathway
Vasopressin-regulated water reabsorption
Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    361 (AQP4)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    361 (AQP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q11.2-q12.1
AA seq 323 aa AA seqDB search
MSDRPTARRWGKCGPLCTRENIMVAFKGVWTQAFWKAVTAEFLAMLIFVLLSLGSTINWG
GTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIA
AQCLGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDS
KRTDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIG
AVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVH
VIDVDRGEEKKGKDQSGEVLSSV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagacccacagcaaggcggtggggtaagtgtggacctttgtgtaccagagag
aacatcatggtggctttcaaaggggtctggactcaagctttctggaaagcagtcacagcg
gaatttctggccatgcttatttttgttctcctcagcctgggatccaccatcaactggggt
ggaacagaaaagcctttaccggtcgacatggttctcatctccctttgctttggactcagc
attgcaaccatggtgcagtgctttggccatatcagcggtggccacatcaaccctgcagtg
actgtggccatggtgtgcaccaggaagatcagcatcgccaagtctgtcttctacatcgca
gcccagtgcctgggggccatcattggagcaggaatcctctatctggtcacacctcccagt
gtggtgggaggcctgggagtcaccatggttcatggaaatcttaccgctggtcatggtctc
ctggttgagttgataatcacatttcaattggtgtttactatctttgccagctgtgattcc
aaacggactgatgtcactggctcaatagctttagcaattggattttctgttgcaattgga
catttatttgcaatcaattatactggtgccagcatgaatcccgcccgatcctttggacct
gcagttatcatgggaaattgggaaaaccattggatatattgggttgggcccatcatagga
gctgtcctcgctggtggcctttatgagtatgtcttctgtccagatgttgaattcaaacgt
cgttttaaagaagccttcagcaaagctgcccagcaaacaaaaggaagctacatggaggtg
gaggacaacaggagtcaggtagagacggatgacctgattctaaaacctggagtggtgcat
gtgattgacgttgaccggggagaggagaagaaggggaaagaccaatctggagaggtattg
tcttcagtatga

DBGET integrated database retrieval system