KEGG   Homo sapiens (human): 3611Help
Entry
3611              CDS       T01001                                 

Gene name
ILK, HEL-S-28, ILK-1, ILK-2, P59, p59ILK
Definition
integrin-linked kinase (EC:2.7.11.1)
Orthology
K06272  
integrin-linked kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Focal adhesion
Bacterial invasion of epithelial cells
Endometrial cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    3611 (ILK)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    3611 (ILK)
 Human Diseases
  Cancers
   05213 Endometrial cancer
    3611 (ILK)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    3611 (ILK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     3611 (ILK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   3611 (ILK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.4
AA seq 452 aa AA seqDB search
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggacgacattttcactcagtgccgggagggcaacgcagtcgccgttcgcctgtggctg
gacaacacggagaacgacctcaaccagggggacgatcatggcttctcccccttgcactgg
gcctgccgagagggccgctctgctgtggttgagatgttgatcatgcggggggcacggatc
aatgtaatgaaccgtggggatgacacccccctgcatctggcagccagtcatggacaccgt
gatattgtacagaagctattgcagtacaaggcagacatcaatgcagtgaatgaacacggg
aatgtgcccctgcactatgcctgtttttggggccaagatcaagtggcagaggacctggtg
gcaaatggggcccttgtcagcatctgtaacaagtatggagagatgcctgtggacaaagcc
aaggcacccctgagagagcttctccgagagcgggcagagaagatgggccagaatctcaac
cgtattccatacaaggacacattctggaaggggaccacccgcactcggccccgaaatgga
accctgaacaaacactctggcattgacttcaaacagcttaacttcctgacgaagctcaac
gagaatcactctggagagctatggaagggccgctggcagggcaatgacattgtcgtgaag
gtgctgaaggttcgagactggagtacaaggaagagcagggacttcaatgaagagtgtccc
cggctcaggattttctcgcatccaaatgtgctcccagtgctaggtgcctgccagtctcca
cctgctcctcatcctactctcatcacacactggatgccgtatggatccctctacaatgta
ctacatgaaggcaccaatttcgtcgtggaccagagccaggctgtgaagtttgctttggac
atggcaaggggcatggccttcctacacacactagagcccctcatcccacgacatgcactc
aatagccgtagtgtaatgattgatgaggacatgactgcccgaattagcatggctgatgtc
aagttctctttccaatgtcctggtcgcatgtatgcacctgcctgggtagcccccgaagct
ctgcagaagaagcctgaagacacaaacagacgctcagcagacatgtggagttttgcagtg
cttctgtgggaactggtgacacgggaggtaccctttgctgacctctccaatatggagatt
ggaatgaaggtggcattggaaggccttcggcctaccatcccaccaggtatttcccctcat
gtgtgtaagctcatgaagatctgcatgaatgaagaccctgcaaagcgacccaaatttgac
atgattgtgcctatccttgagaagatgcaggacaagtag

DBGET integrated database retrieval system