KEGG   Homo sapiens (human): 3614Help
Entry
3614              CDS       T01001                                 

Gene name
IMPDH1, IMPD, IMPD1, IMPDH-I, LCA11, RP10, sWSS2608
Definition
(RefSeq) inosine monophosphate dehydrogenase 1 (EC:1.1.1.205)
  KO
K00088  
IMP dehydrogenase [EC:1.1.1.205]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Disease
H00527  
Retinitis pigmentosa (RP)
H00837  
Leber congenital amaurosis (LCR)
Drug target
Merimepodib: 
Mizoribine: 
Mycophenolic acid (DG00739): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    3614 (IMPDH1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    3614 (IMPDH1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     3614 (IMPDH1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3614 (IMPDH1)
  Exosomal proteins of breast cancer cells
   3614 (IMPDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q31.3-q32
AA seq 514 aa AA seqDB search
MADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKIT
LKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVV
LSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMT
PRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDS
QKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVI
GGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVP
IIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAM
EKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLR
SMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcggactacctgatcagcggcggcaccggctacgtgcccgaggatgggctcaccgcg
cagcagctcttcgccagcgccgacggcctcacctacaacgacttcctgattctcccagga
ttcatagacttcatagctgatgaggtggacctgacctcagccctgacccggaagatcacg
ctgaagacgccactgatctcctcccccatggacactgtgacagaggctgacatggccatt
gccatggctctgatgggaggtattggtttcattcaccacaactgcaccccagagttccag
gccaacgaggtgcggaaggtcaagaagtttgaacagggcttcatcacggaccctgtggtg
ctgagcccctcgcacactgtgggcgatgtgctggaggccaagatgcggcatggcttctct
ggcatccccatcactgagacgggcaccatgggcagcaagctggtgggcatcgtcacctcc
cgagacatcgactttcttgctgagaaggaccacaccaccctcctcagtgaggtgatgacg
ccaaggattgaactggtggtggctccagcaggtgtgacgttgaaagaggcaaatgagatc
ctgcagcgtagcaagaaagggaagctgcctatcgtcaatgattgcgatgagctggtggcc
atcatcgcccgcaccgacctgaagaagaaccgagactaccctctggcctccaaggattcc
cagaagcagctgctctgtggggcagctgtgggcacccgtgaggatgacaaataccgtctg
gacctgctcacccaggcgggcgtcgacgtcatagtcttggactcgtcccaagggaattcg
gtgtatcagatcgccatggtgcattacatcaaacagaagtacccccacctccaggtgatt
ggggggaacgtggtgacagcagcccaggccaagaacctgattgatgctggtgtggacggg
ctgcgcgtgggcatgggctgcggctccatctgcatcacccaggaagtgatggcctgtggt
cggccccagggcactgctgtgtacaaggtggctgagtatgcccggcgctttggtgtgccc
atcatagccgatggcggcatccagaccgtgggacacgtggtcaaggccctggcccttgga
gcctccacagtgatgatgggctccctgctggccgccactacggaggcccctggcgagtac
ttcttctcagacggggtgcggctcaagaagtaccggggcatgggctcactggatgccatg
gagaagagcagcagcagccagaaacgatacttcagcgagggggataaagtgaagatcgcg
cagggtgtctcgggctccatccaggacaaaggatccattcagaagttcgtgccctacctc
atagcaggcatccaacacggctgccaggatatcggggcccgcagcctgtctgtccttcgg
tccatgatgtactcaggagagctcaagtttgagaagcggaccatgtcggcccagattgag
ggtggtgtccatggcctgcactcttacgaaaagcggctgtactga

DBGET integrated database retrieval system