KEGG   Homo sapiens (human): 362Help
Entry
362               CDS       T01001                                 

Gene name
AQP5, AQP-5, PPKB
Definition
(RefSeq) aquaporin 5
  KO
K09867  
aquaporin-5
Organism
hsa  Homo sapiens (human)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    362 (AQP5)
Transporters [BR:hsa02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    362 (AQP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13
AA seq 265 aa AA seqDB search
MKKEVCSVAFLKAVFAEFLATLIFVFFGLGSALKWPSALPTILQIALAFGLAIGTLAQAL
GPVSGGHINPAITLALLVGNQISLLRAFFYVAAQLVGAIAGAGILYGVAPLNARGNLAVN
ALNNNTTQGQAMVVELILTFQLALCIFASTDSRRTSPVGSPALSIGLSVTLGHLVGIYFT
GCSMNPARSFGPAVVMNRFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIK
GTYEPDEDWEEQREERKKTMELTTR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggaggtgtgctccgtggccttcctcaaggccgtgttcgcagagttcttggcc
accctcatcttcgtcttctttggcctgggctcggccctcaagtggccgtcggcgctgcct
accatcctgcagatcgcgctggcgtttggcctggccataggcacgctggcccaggccctg
ggacccgtgagcggcggccacatcaaccccgccatcaccctggccctcttggtgggcaac
cagatctcgctgctccgggctttcttctacgtggcggcccagctggtgggcgccattgcc
ggggctggcatcctctacggtgtggcaccgctcaatgcccggggcaatctggccgtcaac
gcgctcaacaacaacacaacgcagggccaggccatggtggtggagctgattctgaccttc
cagctggcactctgcatcttcgcctccactgactcccgccgcaccagccctgtgggctcc
ccagccctgtccattggcctgtctgtcaccctgggccaccttgtcggaatctacttcact
ggctgctccatgaacccagcccgctcttttggccctgcggtggtcatgaatcggttcagc
cccgctcactgggttttctgggtagggcccatcgtgggggcggtcctggctgccatcctt
tacttctacctgctcttccccaactccctgagcctgagtgagcgtgtggccatcatcaaa
ggcacgtatgagcctgacgaggactgggaggagcagcgggaagagcggaagaagaccatg
gagctgaccacccgctga

DBGET integrated database retrieval system