KEGG   Homo sapiens (human): 3623Help
Entry
3623              CDS       T01001                                 

Gene name
INHA
Definition
(RefSeq) inhibin alpha subunit
  KO
K05500  inhibin, alpha
Organism
hsa  Homo sapiens (human)
Disease
H00627  Premature ovarian failure
Brite
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   3623 (INHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta
Motif
Other DBs
NCBI-GeneID: 3623
NCBI-ProteinID: NP_002182
OMIM: 147380
HGNC: 6065
Ensembl: ENSG00000123999
Vega: OTTHUMG00000059237
Pharos: P05111(Tbio)
UniProt: P05111
Position
2q35
AA seq 366 aa AA seqDB search
MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPR
RHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQH
TRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLH
LATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWP
WSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIP
PNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLT
QHCACI
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgcacctactgctcttcttgctgctgaccccacagggtgggcacagctgccag
gggctggagctggcccgggaacttgttctggccaaggtgagggccctgttcttggatgcc
ttggggccccccgcggtgaccagggaaggtggggaccctggagtcaggcggctgccccga
agacatgccctggggggcttcacacacaggggctctgagcccgaggaagaggaggatgtc
tcccaagccatccttttcccagccacagatgccagctgtgaggacaagtcagctgccaga
gggctggcccaggaggctgaggagggcctcttcagatacatgttccggccatcccagcat
acacgcagccgccaggtgacttcagcccagctgtggttccacaccgggctggacaggcag
ggcacagcagcctccaatagctctgagcccctgctaggcctgctggcactgtcaccggga
ggacccgtggctgtgcccatgtctttgggccatgctccccctcactgggccgtgctgcac
ctggccacctctgctctctctctgctgacccaccccgtcctggtgctgctgctgcgctgt
cccctctgtacctgctcagcccggcctgaggccacgcccttcctggtggcccacactcgg
accagaccacccagtggaggggagagagcccgacgctcaactcccctgatgtcctggcct
tggtctccctctgctctgcgcctgctgcagaggcctccggaggaaccggctgcccatgcc
aactgccacagagtagcactgaacatctccttccaggagctgggctgggaacggtggatc
gtgtaccctcccagtttcatcttccactactgtcatggtggttgtgggctgcacatccca
ccaaacctgtcccttccagtccctggggctccccctaccccagcccagccctactccttg
ctgccaggggcccagccctgctgtgctgctctcccagggaccatgaggcccctacatgtc
cgcaccacctcggatggaggttactctttcaagtatgagacagtgcccaaccttctcacg
cagcactgtgcttgtatctaa

DBGET integrated database retrieval system