KEGG   Homo sapiens (human): 3623Help
Entry
3623              CDS       T01001                                 

Gene name
INHA
Definition
(RefSeq) inhibin, alpha
  KO
K05500  
inhibin, alpha
Organism
hsa  Homo sapiens (human)
Disease
H00627  
Premature ovarian failure
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q35
AA seq 366 aa AA seqDB search
MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPR
RHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQH
TRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLH
LATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWP
WSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIP
PNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLT
QHCACI
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgcacctactgctcttcttgctgctgaccccacagggtgggcacagctgccag
gggctggagctggcccgggaacttgttctggccaaggtgagggccctgttcttggatgcc
ttggggccccccgcggtgaccagggaaggtggggaccctggagtcaggcggctgccccga
agacatgccctggggggcttcacacacaggggctctgagcccgaggaagaggaggatgtc
tcccaagccatccttttcccagccacagatgccagctgtgaggacaagtcagctgccaga
gggctggcccaggaggctgaggagggcctcttcagatacatgttccggccatcccagcat
acacgcagccgccaggtgacttcagcccagctgtggttccacaccgggctggacaggcag
ggcacagcagcctccaatagctctgagcccctgctaggcctgctggcactgtcaccggga
ggacccgtggctgtgcccatgtctttgggccatgctccccctcactgggccgtgctgcac
ctggccacctctgctctctctctgctgacccaccccgtcctggtgctgctgctgcgctgt
cccctctgtacctgctcagcccggcctgaggccacgcccttcctggtggcccacactcgg
accagaccacccagtggaggggagagagcccgacgctcaactcccctgatgtcctggcct
tggtctccctctgctctgcgcctgctgcagaggcctccggaggaaccggctgcccatgcc
aactgccacagagtagcactgaacatctccttccaggagctgggctgggaacggtggatc
gtgtaccctcccagtttcatcttccactactgtcatggtggttgtgggctgcacatccca
ccaaacctgtcccttccagtccctggggctccccctaccccagcccagccctactccttg
ctgccaggggcccagccctgctgtgctgctctcccagggaccatgaggcccctacatgtc
cgcaccacctcggatggaggttactctttcaagtatgagacagtgcccaaccttctcacg
cagcactgtgcttgtatctaa

DBGET integrated database retrieval system