KEGG   Homo sapiens (human): 3626Help
Entry
3626              CDS       T01001                                 

Gene name
INHBC, IHBC
Definition
(RefSeq) inhibin beta C subunit
  KO
K04667  inhibin, beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Module
hsa_M00681  Activin signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    3626 (INHBC)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3626 (INHBC)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3626 (INHBC)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Others
   3626 (INHBC)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   3626 (INHBC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta Anti-TRAP
Motif
Other DBs
NCBI-GeneID: 3626
NCBI-ProteinID: NP_005529
OMIM: 601233
HGNC: 6068
Ensembl: ENSG00000175189
Vega: OTTHUMG00000169994
Pharos: P55103(Tbio)
UniProt: P55103
Position
12q13.3
AA seq 352 aa AA seqDB search
MTSSLLLAFLLLAPTTVATPRAGGQCPACGGPTLELESQRELLLDLAKRSILDKLHLTQR
PTLNRPVSRAALRTALQHLHGVPQGALLEDNREQECEIISFAETGLSTINQTRLDFHFSS
DRTAGDREVQQASLMFFVQLPSNTTWTLKVRVLVLGPHNTNLTLATQYLLEVDASGWHQL
PLGPEAQAACSQGHLTLELVLEGQVAQSSVILGGAAHRPFVAARVRVGGKHQIHRRGIDC
QGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLN
LLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacctcctcattgcttctggcctttctcctcctggctccaaccacagtggccactccc
agagctggcggtcagtgtccagcatgtggggggcccaccttggaactggagagccagcgg
gagctgcttcttgatctggccaagagaagcatcttggacaagctgcacctcacccagcgc
ccaacactgaaccgccctgtgtccagagctgctttgaggactgcactgcagcacctccac
ggggtcccacagggggcacttctagaggacaacagggaacaggaatgtgaaatcatcagc
tttgctgagacaggcctctccaccatcaaccagactcgtcttgattttcacttctcctct
gatagaactgctggtgacagggaggtccagcaggccagtctcatgttctttgtgcagctc
ccttccaataccacttggaccttgaaagtgagagtccttgtgctgggtccacataatacc
aacctcaccttggctactcagtacctgctggaggtggatgccagtggctggcatcaactc
cccctagggcctgaagctcaagctgcctgcagccaggggcacctgaccctggagctggta
cttgaaggccaggtagcccagagctcagtcatcctgggtggagctgcccataggcctttt
gtggcagcccgggtgagagttgggggcaaacaccagattcaccgacgaggcatcgactgc
caaggagggtccaggatgtgctgtcgacaagagttttttgtggacttccgtgagattggc
tggcacgactggatcatccagcctgagggctacgccatgaacttctgcatagggcagtgc
ccactacacatagcaggcatgcctggtattgctgcctcctttcacactgcagtgctcaat
cttctcaaggccaacacagctgcaggcaccactggagggggctcatgctgtgtacccacg
gcccggcgccccctgtctctgctctattatgacagggacagcaacattgtcaagactgac
atacctgacatggtagtagaggcctgtgggtgcagttag

DBGET integrated database retrieval system