KEGG   Homo sapiens (human): 3626Help
Entry
3626              CDS       T01001                                 

Gene name
INHBC, IHBC
Definition
inhibin, beta C
Orthology
K04667  
inhibin, beta
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    3626 (INHBC)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3626 (INHBC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.1
AA seq 352 aa AA seqDB search
MTSSLLLAFLLLAPTTVATPRAGGQCPACGGPTLELESQRELLLDLAKRSILDKLHLTQR
PTLNRPVSRAALRTALQHLHGVPQGALLEDNREQECEIISFAETGLSTINQTRLDFHFSS
DRTAGDREVQQASLMFFVQLPSNTTWTLKVRVLVLGPHNTNLTLATQYLLEVDASGWHQL
PLGPEAQAACSQGHLTLELVLEGQVAQSSVILGGAAHRPFVAARVRVGGKHQIHRRGIDC
QGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLN
LLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacctcctcattgcttctggcctttctcctcctggctccaaccacagtggccactccc
agagctggcggtcagtgtccagcatgtggggggcccaccttggaactggagagccagcgg
gagctgcttcttgatctggccaagagaagcatcttggacaagctgcacctcacccagcgc
ccaacactgaaccgccctgtgtccagagctgctttgaggactgcactgcagcacctccac
ggggtcccacagggggcacttctagaggacaacagggaacaggaatgtgaaatcatcagc
tttgctgagacaggcctctccaccatcaaccagactcgtcttgattttcacttctcctct
gatagaactgctggtgacagggaggtccagcaggccagtctcatgttctttgtgcagctc
ccttccaataccacttggaccttgaaagtgagagtccttgtgctgggtccacataatacc
aacctcaccttggctactcagtacctgctggaggtggatgccagtggctggcatcaactc
cccctagggcctgaagctcaagctgcctgcagccaggggcacctgaccctggagctggta
cttgaaggccaggtagcccagagctcagtcatcctgggtggagctgcccataggcctttt
gtggcagcccgggtgagagttgggggcaaacaccagattcaccgacgaggcatcgactgc
caaggagggtccaggatgtgctgtcgacaagagttttttgtggacttccgtgagattggc
tggcacgactggatcatccagcctgagggctacgccatgaacttctgcatagggcagtgc
ccactacacatagcaggcatgcctggtattgctgcctcctttcacactgcagtgctcaat
cttctcaaggccaacacagctgcaggcaccactggagggggctcatgctgtgtacccacg
gcccggcgccccctgtctctgctctattatgacagggacagcaacattgtcaagactgac
atacctgacatggtagtagaggcctgtgggtgcagttag

DBGET integrated database retrieval system