KEGG   Homo sapiens (human): 363Help
Entry
363               CDS       T01001                                 

Gene name
AQP6, AQP2L, KID
Definition
(RefSeq) aquaporin 6
  KO
K09868  aquaporin-6
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    363 (AQP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 363
NCBI-ProteinID: NP_001643
OMIM: 601383
HGNC: 639
Ensembl: ENSG00000086159
Vega: OTTHUMG00000133548
Pharos: Q13520(Tbio)
UniProt: Q13520
Position
12q13.12
AA seq 282 aa AA seqDB search
MDAVEPGGRGWASMLACRLWKAISRALFAEFLATGLYVFFGVGSVMRWPTALPSVLQIAI
TFNLVTAMAVQVTWKASGAHANPAVTLAFLVGSHISLPRAVAYVAAQLVGATVGAALLYG
VMPGDIRETLGINVVRNSVSTGQAVAVELLLTLQLVLCVFASTDSRQTSGSPATMIGISV
ALGHLIGIHFTGCSMNPARSFGPAIIIGKFTVHWVFWVGPLMGALLASLIYNFVLFPDTK
TLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEMESV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggatgcagtggagccagggggacgtggctgggccagcatgttggcgtgcaggctttgg
aaagccatcagcagggcgctgtttgcagagttcctggccacggggctgtatgtgttcttt
ggcgtgggctcagtcatgcgctggcccacagcacttccctccgtgctacagattgccatc
accttcaacctggtcaccgccatggctgtgcaggtcacctggaaggccagcggggcccac
gccaaccccgccgtgacgctggccttcctcgtaggctcccacatctctctgccccgtgct
gtggcctatgtggctgcccagctggtgggggccacggtgggggctgctctgctttatggg
gtcatgccgggagacatccgagagacccttgggatcaacgtggtccggaacagtgtctca
actggccaggcggtggcagtggagctgcttctgaccctgcagctggtgctctgtgtcttc
gcttccaccgacagccgtcagacatcaggctccccggccaccatgattgggatctctgtg
gcactgggccacctcattgggatccacttcactggctgctccatgaatccagcccgctcc
ttcggccctgccatcatcattgggaagttcacagtccactgggtcttctgggtggggccc
ctgatgggagccctcctggcctcactgatctacaacttcgtcctgttccccgacaccaag
accctggcgcagcggctggctatcctcacaggcaccgtagaggtggggacaggggcaggg
gcaggggcggagcccctgaagaaggaatcccagccgggttcgggagccgtggagatggag
agtgtgtga

DBGET integrated database retrieval system