KEGG   Homo sapiens (human): 3632Help
Entry
3632              CDS       T01001                                 

Gene name
INPP5A, 5PTASE
Definition
inositol polyphosphate-5-phosphatase, 40kDa (EC:3.1.3.56)
Orthology
K01106  
inositol-1,4,5-trisphosphate 5-phosphatase [EC:3.1.3.56]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:hsa00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:hsa04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q26.3
AA seq 412 aa AA seqDB search
MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKN
YEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQF
DFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDL
VNIHLFHDASNLVAWETSPSVYSGIRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSK
SVVETLCTKATMQTVRAADTNEVVKLIFRESDNDRKVMLQLEKKLFDYFNQEVFRDNNGT
ALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKEL
VLRSESEEKVVTYDHIGPNVCMGDHKPVFLAFRIMPGAGKPHAHVHKCCVVQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaaggcggccgccccgggcaccgcggtgctgctggtcacggccaacgtgggc
tcgctcttcgacgacccagaaaacctgcagaagaactggcttcgggaattttaccaggtc
gtgcacacacacaagccgcacttcatggccttgcactgtcaggagtttggagggaagaac
tacgaggcctccatgtcccacgtggacaagttcgtcaaagaactattgtcgagtgatgcg
atgaaagaatataacagggctcgagtctacctggatgaaaactacaaatcccaggagcac
ttcacggcactaggaagcttttattttcttcatgagtccttaaaaaacatctaccagttt
gactttaaagctaagaagtatagaaaggtcgctggcaaagagatctactcggatacctta
gagagcacgcccatgctggagaaggagaagtttccgcaggactacttccccgagtgcaaa
tggtcaagaaaaggcttcatccggacgaggtggtgcattgcagactgtgcctttgacttg
gtgaatatccatcttttccatgatgcttccaatctggtcgcctgggaaacaagcccttcc
gtgtactcgggaatccggcacaaggcactgggctacgtgctggacagaatcattgatcag
cgattcgagaaggtttcctactttgtatttggtgatttcaacttccggctggattccaag
tccgtcgtggagacgctctgcacaaaagccaccatgcagacggtccgggccgccgacacc
aatgaagtggtgaagctcatatttcgtgagtcggacaacgaccggaaggttatgctccag
ttagaaaagaaactcttcgactacttcaaccaggaggttttccgagacaacaacggcacc
gcgctcttggagtttgacaaggagttgtctgtctttaaggacagactgtatgaactggac
atctcgttccctcccagctacccgtacagtgaggacgcccgccagggtgagcagtacatg
aacacccggtgcccagcctggtgtgaccgcatcctcatgtccccgtctgccaaggagctg
gtgctgcggtcggagagcgaggagaaggttgtcacctatgaccacattgggcccaacgtc
tgcatgggagaccacaagcccgtgttcctggccttccgaatcatgcccggggcaggtaaa
cctcatgcccatgtgcacaagtgttgtgtcgtgcagtga

DBGET integrated database retrieval system