KEGG   Homo sapiens (human): 3633Help
Entry
3633              CDS       T01001                                 

Gene name
INPP5B, 5PTase
Definition
inositol polyphosphate-5-phosphatase, 75kDa (EC:3.1.3.36)
Orthology
K01099  
phosphatidylinositol-bisphosphatase [EC:3.1.3.36]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3633 (INPP5B)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    3633 (INPP5B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.36  phosphoinositide 5-phosphatase
     3633 (INPP5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p34
AA seq 913 aa AA seqDB search
MDQSVAIQETLAEGEYCVIAVQGVLCEGDSRQSRLLGLVRYRLEHGGQEHALFLYTHRRM
AITGDDVSLDQIVPVSRDFTLEEVSPDGELYILGSDVTVQLDTAELSLVFQLPFGSQTRM
FLHEVARACPGFDSATRDPEFLWLSRYRCAELELEMPTPRGCNSALVTWPGYATIGGGGS
NFDGLRPNGKGVPMDQSSRGQDKPESLQPRQNKSKSEITDMVRSSTITVSDKAHILSMQK
FGLRDTIVKSHLLQKEEDYTYIQNFRFFAGTYNVNGQSPKECLRLWLSNGIQAPDVYCVG
FQELDLSKEAFFFHDTPKEEEWFKAVSEGLHPDAKYAKVKLIRLVGIMLLLYVKQEHAAY
ISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKDICS
RMQFCQPDPSLPPLTISNHDVILWLGDLNYRIEELDVEKVKKLIEEKDFQMLYAYDQLKI
QVAAKTVFEGFTEGELTFQPTYKYDTGSDDWDTSEKCRAPAWCDRILWKGKNITQLSYQS
HMALKTSDHKPVSSVFDIGVRVVNDELYRKTLEEIVRSLDKMENANIPSVSLSKREFCFQ
NVKYMQLKVESFTIHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLEL
FVNKMTATKLNSGEDKIEDILVLHLDRGKDYFLSVSGNYLPSCFGSPIHTLCYMREPILD
LPLETISELTLMPVWTGDDGSQLDSPMEIPKELWMMVDYLYRNAVQQEDLFQQPGLRSEF
EHIRDCLDTGMIDNLSASNHSVAEALLLFLESLPEPVICYSTYHNCLECSGNYTASKQVI
STLPIFHKNVFHYLMAFLRELLKNSAKNHLDENILASIFGSLLLRNPAGHQKLDMTEKKK
AQEFIHQFLCNPL
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggaccagtctgtggcaatccaggagacgctggctgagggggaatactgcgtcatcgcg
gtgcaaggtgtgctgtgtgagggggacagccggcagagccgcctcctgggactcgtgcgc
taccgcctggagcacggcggccaggaacacgctctcttcctctatacgcaccggaggatg
gccattaccggggacgatgtctctctggaccagatagtgccagtctcgcgggattttacg
ctggaagaagtgtccccagatggtgaactctacatccttggctcagatgtgaccgtccag
ctggacacagcagagcttagcctcgtattccaactgccctttggttcacaaaccaggatg
ttcctccacgaagttgccagggcctgtccaggcttcgattctgcgacccgggatcctgaa
ttcctgtggctgtctcggtataggtgcgcagagctggagctggagatgccaacgccgcgc
ggttgtaactcggccctagttacctggccagggtacgcgacaattggcggaggtggttct
aactttgatggtttgagaccaaatgggaagggagtgcctatggaccaaagctccaggggt
caagataaaccagaaagcttgcaaccaagacagaataaatccaagtccgaaattactgac
atggttcgctcctccactatcacagtgtcggacaaggctcatattttatccatgcagaag
tttggactgcgagatacaattgtgaaatcacatctactacagaaagaagaggattacacc
tatatccagaacttcaggttttttgcgggaacatacaatgtaaatgggcagtcccccaaa
gaatgcctccggctgtggctgagcaatggtatccaggccccagatgtctattgtgtaggg
ttccaggagcttgatctgagtaaggaagcttttttctttcacgataccccaaaggaggaa
gagtggttcaaagctgtgtcagagggtcttcatccagatgccaaatatgcaaaggtgaag
cttatccgactggttgggattatgctgctgttatatgtcaaacaggagcatgcagcttat
atctcagaagtggaagccgagactgtggggacaggaatcatggggaggatgggcaacaag
ggaggcgtggcgatcaggttccagttccacaacaccagcatctgcgttgtgaattctcac
ttggcagcccacattgaagagtatgagaggaggaaccaggactataaggacatttgttct
cgaatgcagttttgtcagcctgacccaagccttccccctctcaccatcagcaaccatgat
gtgatcttgtggctgggggacctcaactacaggatagaagagctggatgtggaaaaagtg
aaaaagctcatcgaagagaaggactttcaaatgctgtatgcatatgatcagctgaaaatt
caggtggccgcaaagactgtctttgaaggcttcacagagggtgagctcacattccagcct
acttacaagtatgatacgggctctgacgactgggataccagtgagaagtgccgtgctcct
gcctggtgtgatcggattctctggaaagggaagaacatcactcagctgagttaccagagc
cacatggccctgaagaccagtgaccacaagcctgtcagctcagtgtttgacatcggggtg
agggtcgtaaatgacgagctttaccggaagacactggaggaaattgttcgctccctggat
aagatggaaaatgccaacattccttctgtgtccctgtccaagcgagagttctgttttcag
aatgtgaagtacatgcaattgaaagtagaatcctttacaattcataatggacaagtaccc
tgtcattttgaattcatcaacaagcctgatgaagagtcttactgtaagcagtggctgaat
gccaaccccagcagaggcttcctcctgccagattctgatgttgagattgacttggagctc
ttcgtaaataagatgacagctacaaagctcaactcgggtgaagacaaaattgaggacatt
ctggttctgcacttggacaggggaaaggattactttttgtctgtgtctgggaactacctg
cccagctgttttgggtctcccattcatacactgtgttacatgagagagccaatcttggac
ctaccacttgaaaccattagtgagctgactctgatgccagtatggactggagatgatggg
agccagttggatagccccatggaaatccccaaagagctctggatgatggttgattacctg
taccgaaatgctgtccagcaggaagatctgtttcagcaaccaggcctgaggtcagaattt
gaacatatcagggactgcttggatactggaatgattgataacctctctgccagcaatcat
tctgtagccgaagccctgctgcttttcctggagagccttccagagcctgtcatctgttac
agcacctaccataactgcttggagtgttctggcaactacacagcaagcaaacaggtcatt
tctactctccccatattccacaaaaatgtcttccactacttgatggcgtttttgcgagaa
ctgctgaaaaattcagcaaaaaatcatttggatgagaatattctagctagcatatttggc
agcttattgcttcgaaacccagctggtcaccaaaagcttgatatgacagagaagaagaag
gctcaagaatttattcaccagttcctctgcaacccactctga

DBGET integrated database retrieval system