KEGG   Homo sapiens (human): 3635Help
Entry
3635              CDS       T01001                                 

Gene name
INPP5D, SHIP, SHIP-1, SHIP1, SIP-145, hp51CN, p150Ship
Definition
inositol polyphosphate-5-phosphatase, 145kDa (EC:3.1.3.86)
Orthology
K03084  
phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 [EC:3.1.3.86]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3635 (INPP5D)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    3635 (INPP5D)
 Organismal Systems
  Immune system
   04662 B cell receptor signaling pathway
    3635 (INPP5D)
   04664 Fc epsilon RI signaling pathway
    3635 (INPP5D)
   04666 Fc gamma R-mediated phagocytosis
    3635 (INPP5D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.86  phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase
     3635 (INPP5D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q37.1
AA seq 1189 aa AA seqDB search
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNED
DKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQYPVPLEEEDTGDDPEEDTVESV
VSPPELPPRNIPLTASSCEAKEVPFSNENPRATETSRPSLSETLFQRLQSMDTSGLPEEH
LKAIQDYLSTQLAQDSEFVKTGSSSLPHLKKLTTLLCKELYGEVIRTLPSLESLQRLFDQ
QLSPGLRPRPQVPGEANPINMVSKLSQLTSLLSSIEDKVKALLHEGPESPHRPSLIPPVT
FEVKAESLGIPQKMQLKVDVESGKLIIKKSKDGSEDKFYSHKKILQLIKSQKFLNKLVIL
VETEKEKILRKEYVFADSKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGNAPPPK
KITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLSEKEWLEILKHSLQEITSVTFKTV
AIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNS
HLTSGSEKKLRRNQNYMNILRFLALGDKKLSPFNITHRFTHLFWFGDLNYRVDLPTWEAE
TIIQKIKQQQYADLLSHDQLLTERREQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQK
ATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFVSKN
GPGTVDSQGQIEFLRCYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGSEGELVVKF
GETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLEATETQLPIYTPLTHH
GELTGHFQGEIKLQTSQGKTREKLYDFVKTERDESSGPKTLKSLTSHDPMKQWEVTSRAP
PCSGSSITEIINPNYMGVGPFGPPMPLHVKQTLSPDQQPTAWSYDQPPKDSPLGPCRGES
PPTPPGQPPISPKKFLPSTANRGLPPRTQESRPSDLGKNAGDTLPQEDLPLTKPEMFENP
LYGSLSSFPKPAPRKDQESPKMPRKEPPPCPEPGILSPSIVLTKAQEADRGEGPGKQVPA
PRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQTPPTPTPR
PPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEGPPGPLGRTAMQ
NT seq 3570 nt NT seq  +upstreamnt  +downstreamnt
atggtcccctgctggaaccatggcaacatcacccgctccaaggcggaggagctgctttcc
aggacaggcaaggacgggagcttcctcgtgcgtgccagcgagtccatctcccgggcatac
gcgctctgcgtgctgtatcggaattgcgtttacacttacagaattctgcccaatgaagat
gataaattcactgttcaggcatccgaaggcgtctccatgaggttcttcaccaagctggac
cagctcatcgagttttacaagaaggaaaacatggggctggtgacccatctgcaataccct
gtgccgctggaggaagaggacacaggcgacgaccctgaggaggacacagtagaaagtgtc
gtgtctccacccgagctgcccccaagaaacatcccgctgactgccagctcctgtgaggcc
aaggaggttcctttttcaaacgagaatccccgagcgaccgagaccagccggccgagcctc
tccgagacattgttccagcgactgcaaagcatggacaccagtgggcttccagaagagcat
cttaaggccatccaagattatttaagcactcagctcgcccaggactctgaatttgtgaag
acagggtccagcagtcttcctcacctgaagaaactgaccacactgctctgcaaggagctc
tatggagaagtcatccggaccctcccatccctggagtctctgcagaggttatttgaccag
cagctctccccgggcctccgtccacgtcctcaggttcctggtgaggccaatcccatcaac
atggtgtccaagctcagccaactgacaagcctgttgtcgtccattgaagacaaggtcaag
gccttgctgcacgagggtcctgagtctccgcaccggccctcccttatccctccagtcacc
tttgaggtgaaggcagagtctctggggattcctcagaaaatgcagctcaaagtcgacgtt
gagtctgggaaactgatcattaagaagtccaaggatggttctgaggacaagttctacagc
cacaagaaaatcctgcagctcattaagtcacagaaatttctgaataagttggtgatcttg
gtggaaacagagaaggagaagatcctgcggaaggaatatgtttttgctgactccaaaaag
agagaaggcttctgccagctcctgcagcagatgaagaacaagcactcagagcagccggag
cccgacatgatcaccatcttcatcggcacctggaacatgggtaacgccccccctcccaag
aagatcacgtcctggtttctctccaaggggcagggaaagacgcgggacgactctgcggac
tacatcccccatgacatttacgtgatcggcacccaagaggaccccctgagtgagaaggag
tggctggagatcctcaaacactccctgcaagaaatcaccagtgtgacttttaaaacagtc
gccatccacacgctctggaacatccgcatcgtggtgctggccaagcctgagcacgagaac
cggatcagccacatctgtactgacaacgtgaagacaggcattgcaaacacactggggaac
aagggagccgtgggggtgtcgttcatgttcaatggaacctccttagggttcgtcaacagc
cacttgacttcaggaagtgaaaagaaactcaggcgaaaccaaaactatatgaacattctc
cggttcctggccctgggcgacaagaagctgagtccctttaacatcactcaccgcttcacg
cacctcttctggtttggggatcttaactaccgtgtggatctgcctacctgggaggcagaa
accatcatccagaaaatcaagcagcagcagtacgcagacctcctgtcccacgaccagctg
ctcacagagaggagggagcagaaggtcttcctacacttcgaggaggaagaaatcacgttt
gccccaacctaccgttttgagagactgactcgggacaaatacgcctacaccaagcagaaa
gcgacagggatgaagtacaacttgccttcctggtgtgaccgagtcctctggaagtcttat
cccctggtgcacgtggtgtgtcagtcttatggcagtaccagcgacatcatgacgagtgac
cacagccctgtctttgccacatttgaggcaggagtcacttcccagtttgtctccaagaac
ggtcccgggactgttgacagccaaggacagattgagtttctcaggtgctatgccacattg
aagaccaagtcccagaccaaattctacctggagttccactcgagctgcttggagagtttt
gtcaagagtcaggaaggagaaaatgaagaaggaagtgagggggagctggtggtgaagttt
ggtgagactcttccaaagctgaagcccattatctctgaccctgagtacctgctagaccag
cacatcctcatcagcatcaagtcctctgacagcgacgaatcctatggcgagggctgcatt
gcccttcggttagaggccacagaaacgcagctgcccatctacacgcctctcacccaccat
ggggagttgacaggccacttccagggggagatcaagctgcagacctctcagggcaagacg
agggagaagctctatgactttgtgaagacggagcgtgatgaatccagtgggccaaagacc
ctgaagagcctcaccagccacgaccccatgaagcagtgggaagtcactagcagggcccct
ccgtgcagtggctccagcatcactgaaatcatcaaccccaactacatgggagtggggccc
tttgggccaccaatgcccctgcacgtgaagcagaccttgtcccctgaccagcagcccaca
gcctggagctacgaccagccgcccaaggactccccgctggggccctgcaggggagaaagt
cctccgacacctcccggccagccgcccatatcacccaagaagtttttaccctcaacagca
aaccggggtctccctcccaggacacaggagtcaaggcccagtgacctggggaagaacgca
ggggacacgctgcctcaggaggacctgccgctgacgaagcccgagatgtttgagaacccc
ctgtatgggtccctgagttccttccctaagcctgctcccaggaaggaccaggaatccccc
aaaatgccgcggaaggaacccccgccctgcccggaacccggcatcttgtcgcccagcatc
gtgctcaccaaagcccaggaggctgatcgcggcgaggggcccggcaagcaggtgcccgcg
ccccggctgcgctccttcacgtgctcatcctctgccgagggcagggcggccggcggggac
aagagccaagggaagcccaagaccccggtcagctcccaggccccggtgccggccaagagg
cccatcaagccttccagatcggaaatcaaccagcagaccccgcccaccccgacgccgcgg
ccgccgctgccagtcaagagcccggcggtgctgcacctccagcactccaagggccgcgac
taccgcgacaacaccgagctcccgcatcacggcaagcaccggccggaggaggggccacca
gggcctctaggcaggactgccatgcagtga

DBGET integrated database retrieval system