KEGG   Homo sapiens (human): 364Help
Entry
364               CDS       T01001                                 

Gene name
AQP7, AQP7L, AQP9, AQPap, GLYCQTL
Definition
aquaporin 7
Orthology
K08771  
aquaporin-7
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Class
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p13
AA seq 342 aa AA seqDB search
MVQASGHRRSTRGSKMVSWSVIAKIQEILQRKMVREFLAEFMSTYVMMVFGLGSVAHMVL
NKKYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAVTFANCALGRVPWRKFPVYVLGQF
LGSFLAAATIYSLFYTAILHFSGGQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLTG
MLQLCLFAITDQENNPALPGTEALVIGILVVIIGVSLGMNTGYAINPSRDLPPRIFTFIA
GWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYLVFIGSTIPREPLKLEDSVAYEDHGITV
LPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMALEHF
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggttcaagcatccgggcacaggcggtccacccgtggctccaaaatggtctcctggtcc
gtgatagcaaagatccaggaaatactgcagaggaagatggtgcgagagttcctggccgag
ttcatgagcacatatgtcatgatggtattcggccttggttccgtggcccatatggttcta
aataaaaaatatgggagctaccttggtgtcaacttgggttttggcttcggagtcaccatg
ggagtgcacgtggcaggccgcatctctggagcccacatgaacgcagctgtgacctttgct
aactgtgcgctgggccgcgtgccctggaggaagtttccggtctatgtgctggggcagttc
ctgggctccttcctggcggctgccaccatctacagtctcttctacacggccattctccac
ttttcgggtggacagctgatggtgaccggtcccgtcgctacagctggcatttttgccacc
taccttcctgatcacatgacattgtggcggggcttcctgaatgaggcgtggctgaccggg
atgctccagctgtgtctcttcgccatcacggaccaggagaacaacccagcactgccagga
acagaggcgctggtgataggcatcctcgtggtcatcatcggggtgtcccttggcatgaac
acaggatatgccatcaacccgtcccgggacctgcccccccgcatcttcaccttcattgct
ggttggggcaaacaggtcttcagcaatggggagaactggtggtgggtgccagtggtggca
ccacttctgggtgcctatctaggtggcatcatctacctggtcttcattggctccaccatc
ccacgggagcccctgaaattggaggattctgtggcgtatgaagaccacgggataaccgta
ttgcccaagatgggatctcatgaacccacgatctctcccctcacccccgtctctgtgagc
cctgccaacagatcttcagtccaccctgccccacccttacatgaatccatggccctagag
cacttctaa

DBGET integrated database retrieval system