KEGG   Homo sapiens (human): 3645Help
Entry
3645              CDS       T01001                                 

Gene name
INSRR, IRR
Definition
insulin receptor-related receptor (EC:2.7.10.1)
Orthology
K05086  
insulin receptor-related receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    3645 (INSRR)
 Human Diseases
  Cancers
   05215 Prostate cancer
    3645 (INSRR)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     3645 (INSRR)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  InsR family [OT]
   3645 (INSRR)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class II (Insulin receptor family)
   3645 (INSRR)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class II (Insulin receptor family)
   3645 (INSRR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21-q23
AA seq 1297 aa AA seqDB search
MAVPSLWPWGACLPVIFLSLGFGLDTVEVCPSLDIRSEVAELRQLENCSVVEGHLQILLM
FTATGEDFRGLSFPRLTQVTDYLLLFRVYGLESLRDLFPNLAVIRGTRLFLGYALVIFEM
PHLRDVALPALGAVLRGAVRVEKNQELCHLSTIDWGLLQPAPGANHIVGNKLGEECADVC
PGVLGAAGEPCAKTTFSGHTDYRCWTSSHCQRVCPCPHGMACTARGECCHTECLGGCSQP
EDPRACVACRHLYFQGACLWACPPGTYQYESWRCVTAERCASLHSVPGRASTFGIHQGSC
LAQCPSGFTRNSSSIFCHKCEGLCPKECKVGTKTIDSIQAAQDLVGCTHVEGSLILNLRQ
GYNLEPQLQHSLGLVETITGFLKIKHSFALVSLGFFKNLKLIRGDAMVDGNYTLYVLDNQ
NLQQLGSWVAAGLTIPVGKIYFAFNPRLCLEHIYRLEEVTGTRGRQNKAEINPRTNGDRA
ACQTRTLRFVSNVTEADRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGT
QSWNLLDVELPLSRTQEPGVTLASLKPWTQYAVFVRAITLTTEEDSPHQGAQSPIVYLRT
LPAAPTVPQDVISTSNSSSHLLVRWKPPTQRNGNLTYYLVLWQRLAEDGDLYLNDYCHRG
LRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNA
ITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDFEIQEDKVPRERAVLSGLRHF
TEYRIDIHACNHAAHTVGCSAATFVFARTMPHREADGIPGKVAWEASSKNSVLLRWLEPP
DPNGLILKYEIKYRRLGEEATVLCVSRLRYAKFGGVHLALLPPGNYSARVRATSLAGNGS
WTDSVAFYILGPEEEDAGGLHVLLTATPVGLTLLIVLAALGFFYGKKRNRTLYASVNPEY
FSASDMYVPDEWEVPREQISIIRELGQGSFGMVYEGLARGLEAGEESTPVALKTVNELAS
PRECIEFLKEASVMKAFKCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSHLRSLRPEAEN
NPGLPQPALGEMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIGDFGMTRDV
YETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQ
VLKFVMDGGVLEELEGCPLQLQELMSRCWQPNPRLRPSFTHILDSIQEELRPSFRLLSFY
YSPECRGARGSLPTTDAEPDSSPTPRDCSPQNGGPGH
NT seq 3894 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgcctagtctgtggccctggggagcatgcctgcctgtgatcttcctctccttg
ggatttggcctggatacagtagaggtgtgccccagcctggatattcgctcagaggtggca
gagcttcgtcagctggagaactgcagcgtggtggagggccacctgcagatcctgctcatg
ttcacagccaccggggaggacttccgcggcctcagcttccctcgcctcacccaggtcacc
gactacctgctgctcttccgtgtctacggactggagagcctgcgcgacctcttccccaac
ctagcagtcatccgcgggacgcgcctcttcctgggctatgcactggtcatctttgagatg
ccacatctgcgtgacgtggcactgcctgcacttggggccgtgctgcgtggggctgtgcgt
gtggagaagaaccaggagctctgccacctctccaccattgactggggactgctgcagcca
gcacctggcgccaaccacatcgtgggcaacaagctgggcgaggagtgtgctgacgtgtgc
cctggtgtgctgggtgctgctggtgagccctgtgccaagaccaccttcagcgggcacact
gactacagatgctggacctccagccactgccagagagtgtgcccctgcccccatgggatg
gcttgcacagcgaggggcgagtgctgccacaccgaatgcctggggggctgcagccagcca
gaagaccctcgtgcctgtgtagcttgccgccacctctacttccagggtgcctgcctgtgg
gcctgcccgccaggcacctaccagtatgagtcctggcgctgtgtcacagctgagcgctgt
gccagcctgcactctgtgcccggccgtgcctccaccttcggcatacaccagggcagttgc
ctggcccagtgcccttctggcttcacccgtaatagcagcagcatattctgccacaagtgc
gaggggctgtgccctaaagagtgcaaggtaggcaccaagaccatcgactccatccaggcg
gcacaggatcttgtgggctgcacgcatgtggagggaagcctcatcctcaaccttcgccag
ggctacaacctggagccacagctgcagcacagcctggggctggtagaaaccattactggc
ttcctcaaaatcaagcactcctttgccctcgtgtccctgggctttttcaagaacctcaaa
ctaatccggggagacgccatggtggatgggaactacactctctacgtgctggacaaccag
aacctacaacagctagggtcctgggtggccgcggggctcaccattcccgtgggcaagatc
tacttcgccttcaacccgcgcctctgcttggaacacatctaccgactggaggaggtgaca
ggcacgcgaggtcggcagaacaaggctgagatcaacccccgcaccaacggagaccgcgcc
gcctgccagactcgcaccctgcgcttcgtgtccaacgtgacggaggcagaccgcatcctg
ctacgctgggagcgctatgagccactggaggcccgcgacctgctcagcttcatcgtgtac
tacaaggagtccccattccagaacgccacagagcacgtgggtccagatgcttgtggaacc
cagagctggaacctgctggatgtggagctgcccctaagccgcacccaggagccaggggtg
accctagcctccctcaagccttggacacagtacgcagtgtttgtgcgggccatcacgcta
accactgaggaggacagccctcatcaaggagcccagagtcccatcgtctacctccgaacg
ctgcctgcagctcccacggtgccccaagacgtcatctccacgtccaactcctcctcccac
ctcctggtgcgctggaagccaccgacccagcgcaatgggaacctcacctactacctggtg
ctgtggcagcggctggcagaggacggcgacctctacctcaatgactactgccaccgcggc
ttgcggctgcccaccagcaacaacgatccgcgcttcgacggcgaagacggggatcctgag
gccgagatggagtccgactgctgcccttgccagcacccacctcctggtcaggttctgccc
ccgctggaggcgcaagaggcctcgttccagaagaagtttgaaaactttctacacaacgcg
atcaccatccccatatccccttggaaggtgacgtccatcaacaagagcccccaaagggac
tcagggcggcaccgccgggcagctgggcccctccggctggggggcaacagctcggatttc
gagatccaggaggacaaggtgccccgtgagcgagcggtgctgagcggcctgcgccacttc
acggaataccggatcgacatccatgcctgcaaccacgcggcgcacaccgtgggctgcagc
gccgccaccttcgtctttgcgcgcaccatgccccacagagaggctgatggtattccagga
aaggtggcctgggaggcctccagcaagaacagtgtccttctgcgctggctcgagccacca
gaccccaacggactcatcctcaagtacgaaatcaagtaccgccgcttgggagaggaggcc
acagtgctgtgtgtgtcccgtcttcgatatgcgaagtttgggggagtccacctggccctg
ctgccccctggaaactactctgccagggttagggcaacctcactggctggcaatggctct
tggacagacagtgttgccttctacatccttggcccagaggaggaggatgctggggggctg
catgtcctcctcactgccacccctgtggggctcacgctgctcatcgttcttgctgccctt
ggtttcttctacggcaagaagagaaacagaaccctgtatgcttctgtgaatccagagtac
ttcagcgcctctgatatgtatgtccctgatgaatgggaggtgcctcgggagcagatctcg
ataatccgggaactgggccagggctcttttgggatggtatatgaggggctggcacgagga
cttgaggctggagaggagtccacacccgtggccctgaagacggtgaatgagctggccagc
ccacgggaatgcattgagttcctcaaggaagcttctgtcatgaaagccttcaagtgtcac
catgtggtgcgtctcctgggtgtggtatctcagggccagccaactctggtcatcatggag
ttaatgacccgtggggacctcaagagccatcttcgatctttgcggcctgaggcagagaac
aaccctgggctcccacagccagcattgggggaaatgatccaaatggctggtgagattgca
gacggcatggcctaccttgctgccaacaagtttgtgcaccgagatctagcagcccgcaac
tgcatggtgtcccaggacttcaccgtcaagatcggggacttcgggatgactcgggacgtg
tatgagacagactattaccgcaagggtgggaaggggctgctgcccgtgcgctggatggcc
cccgagtccctcaaagatgggatcttcaccacccactcggatgtctggtcctttggcgtg
gtactctgggagattgtgaccctggcagaacaaccctaccagggcctgtccaatgagcag
gtgctgaagttcgtcatggatggcggggtcctggaggagctggagggctgtccccttcag
ctgcaggagctgatgagccgctgctggcagccgaacccacgcctgcgcccatctttcaca
cacattctggacagcatacaggaggagctgcggccctccttccgcctcctctccttctac
tacagcccggaatgccggggggcccggggctccctgcctaccaccgatgcagagcctgac
tcctcacccactccaagagactgcagccctcaaaatgggggtccagggcactga

DBGET integrated database retrieval system