KEGG   Homo sapiens (human): 3656Help
Entry
3656              CDS       T01001                                 

Gene name
IRAK2, IRAK-2
Definition
interleukin-1 receptor-associated kinase 2
Orthology
K04731  
interleukin-1 receptor-associated kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Neurotrophin signaling pathway
Tuberculosis
Disease
H01358  
Atopic dermatitis
Class
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p25.3
AA seq 625 aa AA seqDB search
MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITREL
LWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASV
RKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFST
SIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLR
ETACSSPGSIERFFQAELQICLRCCHPNVLPVLGFCAARQFHSFIYPYMANGSLQDRLQG
QGGSDPLPWPQRVSICSGLLCAVEYLHGLEIIHSNVKSSNVLLDQNLTPKLAHPMAHLCP
VNKRSKYTMMKTHLLRTSAAYLPEDFIRVGQLTKRVDIFSCGIVLAEVLTGIPAMDNNRS
PVYLKDLLLSDIPSSTASLCSRKTGVENVMAKEICQKYLEKGAGRLPEDCAEALATAACL
CLRRRNTSLQEVCGSVAAVEERLRGRETLLPWSGLSEGTGSSSNTPEETDDVDNSSLDAS
SSMSVAPWAGAATPLLPTENGEGRLRVIVGREADSSSEACVGLEPPQDVTETSWQIEINE
AKRKLMENILLYKEEKVDSIELFGP
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggcctgctacatctaccagctgccctcctgggtgctggacgacctgtgccgcaacatg
gacgcgctcagcgagtgggactggatggagttcgcctcctacgtgatcacagacctgacc
cagctgcggaagatcaagtccatggagcgggtgcagggtgtgagcatcacgcgggagctg
ctgtggtggtggggcatgcggcaggccaccgtccagcaacttgtggacctcctgtgccgc
ctggagctctaccgggctgcccagatcatcctgaactggaaaccggctcctgaaatcagg
tgtcccattccagccttccctgactctgtgaagccagaaaagcctttggcagcttctgta
agaaaggctgaggatgaacaggaagaggggcagcctgtgaggatggccacctttccaggc
ccagggtcctctccagccagagcccaccagccggcctttctccagcctcctgaagaagat
gcccctcattccttgagaagcgacctccccacttcgtctgattcaaaggacttcagcacc
tccattcctaagcaggaaaaacttttgagcttggctggagacagccttttctggagtgag
gcagacgtggtccaggcaaccgatgacttcaatcaaaaccgcaaaatcagccaggggacc
tttgctgacgtctacagagggcacaggcacgggaagccattcgtcttcaagaagctcaga
gagacagcctgttcaagtccaggatcaatcgaaagattcttccaggcagagttgcagatt
tgtcttagatgctgccaccccaatgtcttacctgtgctgggcttctgtgctgcaagacag
tttcacagcttcatctacccctacatggcaaatggttccctacaggacagactgcagggt
cagggtggctcggaccccctcccctggccccagcgtgtcagcatctgctcagggctgctc
tgtgccgtcgagtacctgcatggtctggagatcatccacagcaacgtcaagagctctaat
gtcttgctggaccaaaatctcacccccaaacttgctcacccaatggctcatctgtgtcct
gtcaacaaaaggtcaaaatacaccatgatgaagactcacctgctccggacgtcagccgcg
tatctgccagaggatttcatccgggtggggcagctgacaaagcgagtggacatcttcagc
tgtggaatagtgttggccgaggtcctcacgggcatccctgcaatggataacaaccgaagc
ccggtttacctgaaggacttactcctcagtgatattccaagcagcaccgcctcgctctgc
tccaggaagacgggcgtggagaacgtgatggcaaaggagatctgccagaagtacctggag
aagggcgcagggaggcttccggaggactgcgccgaggccctggccacggctgcctgcctg
tgcctgcggaggcgtaacaccagcctgcaggaggtgtgtggctctgtggctgctgtggaa
gagcggctccgaggtcgggagacgttgctcccttggagtgggctttctgagggtacaggc
tcttcttccaacaccccagaggaaacagacgacgttgacaattccagccttgatgcctcc
tcctccatgagtgtggcaccctgggcaggggctgccaccccacttctccccacagagaat
ggggaaggaaggctgcgggtcatcgtgggaagggaggctgactcctcctctgaggcctgt
gttggcctggagcctccccaggatgttacagaaacttcgtggcaaattgagatcaatgag
gccaaaaggaaactgatggagaatattctgctctacaaagaggaaaaagtggacagcatt
gagctctttggcccctga

DBGET integrated database retrieval system