KEGG   Homo sapiens (human): 366Help
Entry
366               CDS       T01001                                 

Gene name
AQP9, AQP-9, HsT17287, SSC1
Definition
aquaporin 9
Orthology
K09877  
aquaporin-9
Organism
hsa  Homo sapiens (human)
Pathway
Bile secretion
Class
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q
AA seq 295 aa AA seqDB search
MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITI
NVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATV
FGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIF
DSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAG
NNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctgagggagcagaaaagggaaaaagcttcaagcagagactggtcttgaagagc
agcttagcgaaagaaaccctctctgagttcttgggcacgttcatcttgattgtccttgga
tgtggctgtgttgcccaagctattctcagtcgaggacgttttggaggggtcatcactatc
aatgttggattttcaatggcagttgcaatggccatttatgtggctggcggtgtctctggt
ggtcacatcaacccagctgtgtctttagcaatgtgtctctttggacggatgaaatggttc
aaattgccattttatgtgggagcccagttcttgggagcctttgtgggggctgcaaccgtc
tttggcatttactatgatggacttatgtcctttgctggtggaaaactgctgatcgtggga
gaaaatgcaacagcacacatttttgcaacatacccagctccgtatctatctctggcgaac
gcatttgcagatcaagtggtggccaccatgatactcctcataatcgtctttgccatcttt
gactccagaaacttgggagcccccagaggcctagagcccattgccatcggcctcctgatt
attgtcattgcttcctccctgggactgaacagtggctgtgccatgaacccagctcgagac
ctgagtcccagacttttcactgccttggcaggctgggggtttgaagtcttcagagctgga
aacaacttctggtggattcctgtagtgggccctttggttggtgctgtcattggaggcctc
atctatgttcttgtcattgaaatccaccatccagagcctgactcagtctttaagacagaa
caatctgaggacaaaccagagaaatatgaactcagtgtcatcatgtag

DBGET integrated database retrieval system