KEGG   Homo sapiens (human): 3663Help
Entry
3663              CDS       T01001                                 

Gene name
IRF5, SLEB10
Definition
interferon regulatory factor 5
Orthology
K09446  
interferon regulatory factor 5
Organism
hsa  Homo sapiens (human)
Pathway
Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    3663 (IRF5)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    3663 (IRF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q32
AA seq 498 aa AA seqDB search
MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGD
NTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEV
CSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLRPPTLQ
PPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLI
SPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFP
SPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNP
IQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVP
VAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPG
AGLGVGQGPWPMHPAGMQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagtccatcccagtggctcccaccccaccccgccgcgtgcggctgaagccctgg
ctggtggcccaggtgaacagctgccagtacccagggcttcaatgggtcaacggggaaaag
aaattattctgcatcccctggaggcatgccacaaggcatggtcccagccaggacggagat
aacaccatcttcaaggcctgggccaaggagacagggaaatacaccgaaggcgtggatgaa
gccgatccggccaagtggaaggccaacctgcgctgtgcccttaacaagagccgggacttc
cgcctcatctacgacgggccccgggacatgccacctcagccctacaagatctacgaggtc
tgctccaatggccctgctcccacagactcccagccccctgaggattactcttttggtgca
ggagaggaggaggaagaagaggaagagctgcagaggatgttgccaagcctgagcctcaca
gaggatgtcaagtggccgcccactctgcagccgcccactctgcggccgcctactctgcag
ccgcccactctgcagccgcccgtggtgctgggtccccctgctccagaccccagccccctg
gctcctccccctggcaaccctgctggcttcagggagcttctctctgaggtcctggagcct
gggcccctgcctgccagcctgccccctgcaggcgaacagctcctgccagacctgctgatc
agcccccacatgctgcctctgaccgacctggagatcaagtttcagtaccgggggcggcca
ccccgggccctcaccatcagcaacccccatggctgccggctcttctacagccagctggag
gccacccaggagcaggtggaactcttcggccccataagcctggagcaagtgcgcttcccc
agccctgaggacatccccagtgacaagcagcgcttctacacgaaccagctgctggatgtc
ctggaccgcgggctcatcctccagctacagggccaggacctttatgccatccgcctgtgt
cagtgcaaggtgttctggagcgggccttgtgcctcagcccatgactcatgccccaacccc
atccagcgggaggtcaagaccaagcttttcagcctggagcattttctcaatgagctcatc
ctgttccaaaagggccagaccaacaccccaccacccttcgagatcttcttctgctttggg
gaagaatggcctgaccgcaaaccccgagagaagaagctcattactgtacaggtggtgcct
gtagcagctcgactgctgctggagatgttctcaggggagctatcttggtcagctgatagt
atccggctacagatctcaaacccagacctcaaagaccgcatggtggagcaattcaaggag
ctccatcacatctggcagtcccagcagcggttgcagcctgtggcccaggcccctcctgga
gcaggccttggtgttggccaggggccctggcctatgcacccagctggcatgcaataa

DBGET integrated database retrieval system