KEGG   Homo sapiens (human): 3667Help
Entry
3667              CDS       T01001                                 

Gene name
IRS1, HIRS-1
Definition
insulin receptor substrate 1
Orthology
K16172  
insulin receptor substrate 1
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
FoxO signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Neurotrophin signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Aldosterone-regulated sodium reabsorption
MicroRNAs in cancer
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    3667 (IRS1)
   04022 cGMP - PKG signaling pathway
    3667 (IRS1)
   04151 PI3K-Akt signaling pathway
    3667 (IRS1)
   04152 AMPK signaling pathway
    3667 (IRS1)
   04150 mTOR signaling pathway
    3667 (IRS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    3667 (IRS1)
   04920 Adipocytokine signaling pathway
    3667 (IRS1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    3667 (IRS1)
  Nervous system
   04722 Neurotrophin signaling pathway
    3667 (IRS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    3667 (IRS1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    3667 (IRS1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3667 (IRS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q36
AA seq 1242 aa AA seqDB search
MASPPESDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGH
HDGAAALGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFKEVWQVILKPKGLGQTKNLI
GIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQV
DDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHLNNPPPSQVGLT
RRSRTESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHR
GSARLHPPLNHSRSIPMPASRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSP
SDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGPSTLTAPN
GHYILSRGGNGHRCTPGTGLGTSPALAGDEAASAADLDNRFRKRTHSAGTSPTITHQKTP
SQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPLERRGGHHR
PDSSTLHTDDGYMPMSPGVAPVPSGRKGSGDYMPMSPKSVSAPQQIINPIRRHPQRVDPN
GYMMMSPSGGCSPDIGGGPSSSSSSSNAVPSGTSYGKLWTNGVGGHHSHVLPHPKPPVES
SGGKLLPCTGDYMNMSPVGDSNTSSPSDCYYGPEDPQHKPVLSYYSLPRSFKHTQRPGEP
EEGARHQHLRLSTSSGRLLYAATADDSSSSTSSDSLGGGYCGARLEPSLPHPHHQVLQPH
LPRKVDTAAQTNSRLARPTRLSLGDPKASTLPRAREQQQQQQPLLHPPEPKSPGEYVNIE
FGSDQSGYLSGPVAFHSSPSVRCPSQLQPAPREEETGTEEYMKMDLGPGRRAAWQESTGV
EMGRLGPAPPGAASICRPTRAVPSSRGDYMTMQMSCPRQSYVDTSPAAPVSYADMRTGIA
AEEVSLPRATMAAASSSSAASASPTGPQGAAELAAHSSLLGGPQGPGGMSAFTRVNLSPN
RNQSAKVIRADPQGCRRRHSSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSSEDVKR
HSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQ
PPPPPPPHQPLGSGESSSTRRSSEDLSAYASISFQKQPEDRQ
NT seq 3729 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccctccggagagcgatggcttctcggacgtgcgcaaggtgggctacctgcgc
aaacccaagagcatgcacaaacgcttcttcgtactgcgcgcggccagcgaggctgggggc
ccggcgcgcctcgagtactacgagaacgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcgatcccccttgagagctgcttcaacatcaacaagcgggctgactccaagaac
aagcacctggtggctctctacacccgggacgagcactttgccatcgcggcggacagcgag
gccgagcaagacagctggtaccaggctctcctacagctgcacaaccgtgctaagggccac
cacgacggagctgcggccctcggggcgggaggtggtgggggcagctgcagcggcagctcc
ggccttggtgaggctggggaggacttgagctacggtgacgtgcccccaggacccgcattc
aaagaggtctggcaagtgatcctgaagcccaagggcctgggtcagacaaagaacctgatt
ggtatctaccgcctttgcctgaccagcaagaccatcagcttcgtgaagctgaactcggag
gcagcggccgtggtgctgcagctgatgaacatcaggcgctgtggccactcggaaaacttc
ttcttcatcgaggtgggccgttctgccgtgacggggcccggggagttctggatgcaggtg
gatgactctgtggtggcccagaacatgcacgagaccatcctggaggccatgcgggccatg
agtgatgagttccgccctcgcagcaagagccagtcctcgtccaactgctctaaccccatc
agcgtccccctgcgccggcaccatctcaacaatcccccgcccagccaggtggggctgacc
cgccgatcacgcactgagagcatcaccgccacctccccggccagcatggtgggcgggaag
ccaggctccttccgtgtccgcgcctccagtgacggcgaaggcaccatgtcccgcccagcc
tcggtggacggcagccctgtgagtcccagcaccaacagaacccacgcccaccggcatcgg
ggcagcgcccggctgcaccccccgctcaaccacagccgctccatccccatgccggcttcc
cgctgctcgccttcggccaccagcccggtcagtctgtcgtccagtagcaccagtggccat
ggctccacctcggattgtctcttcccacggcgatctagtgcttcggtgtctggttccccc
agcgatggcggtttcatctcctcggatgagtatggctccagtccctgcgatttccggagt
tccttccgcagtgtcactccggattccctgggccacaccccaccagcccgcggtgaggag
gagctaagcaactatatctgcatgggtggcaaggggccctccaccctgaccgcccccaac
ggtcactacattttgtctcggggtggcaatggccaccgctgcaccccaggaacaggcttg
ggcacgagtccagccttggctggggatgaagcagccagtgctgcagatctggataatcgg
ttccgaaagagaactcactcggcaggcacatcccctaccattacccaccagaagaccccg
tcccagtcctcagtggcttccattgaggagtacacagagatgatgcctgcctacccacca
ggaggtggcagtggaggccgactgccgggacacaggcactccgccttcgtgcccacccgc
tcctacccagaggagggtctggaaatgcaccccttggagcgtcggggggggcaccaccgc
ccagacagctccaccctccacacggatgatggctacatgcccatgtccccaggggtggcc
ccagtgcccagtggccgaaagggcagtggagactatatgcccatgagccccaagagcgta
tctgccccacagcagatcatcaatcccatcagacgccatccccagagagtggaccccaat
ggctacatgatgatgtcccccagcggtggctgctctcctgacattggaggtggccccagc
agcagcagcagcagcagcaacgccgtcccttccgggaccagctatggaaagctgtggaca
aacggggtagggggccaccactctcatgtcttgcctcaccccaaacccccagtggagagc
agcggtggtaagctcttaccttgcacaggtgactacatgaacatgtcaccagtgggggac
tccaacaccagcagcccctccgactgctactacggccctgaggacccccagcacaagcca
gtcctctcctactactcattgccaagatcctttaagcacacccagcgccccggggagccg
gaggagggtgcccggcatcagcacctccgcctttccactagctctggtcgccttctctat
gctgcaacagcagatgattcttcctcttccaccagcagcgacagcctgggtgggggatac
tgcggggctaggctggagcccagccttccacatccccaccatcaggttctgcagccccat
ctgcctcgaaaggtggacacagctgctcagaccaatagccgcctggcccggcccacgagg
ctgtccctgggggatcccaaggccagcaccttacctcgggcccgagagcagcagcagcag
cagcagcccttgctgcaccctccagagcccaagagcccgggggaatatgtcaatattgaa
tttgggagtgatcagtctggctacttgtctggcccggtggctttccacagctcaccttct
gtcaggtgtccatcccagctccagccagctcccagagaggaagagactggcactgaggag
tacatgaagatggacctggggccgggccggagggcagcctggcaggagagcactggggtc
gagatgggcagactgggccctgcacctcccggggctgctagcatttgcaggcctacccgg
gcagtgcccagcagccggggtgactacatgaccatgcagatgagttgtccccgtcagagc
tacgtggacacctcgccagctgcccctgtaagctatgctgacatgcgaacaggcattgct
gcagaggaggtgagcctgcccagggccaccatggctgctgcctcctcatcctcagcagcc
tctgcttccccgactgggcctcaaggggcagcagagctggctgcccactcgtccctgctg
gggggcccacaaggacctgggggcatgagcgccttcacccgggtgaacctcagtcctaac
cgcaaccagagtgccaaagtgatccgtgcagacccacaagggtgccggcggaggcatagc
tccgagactttctcctcaacacccagtgccacccgggtgggcaacacagtgccctttgga
gcgggggcagcagtagggggcggtggcggtagcagcagcagcagcgaggatgtgaaacgc
cacagctctgcttcctttgagaatgtgtggctgaggcctggggagcttgggggagccccc
aaggagccagccaaactgtgtggggctgctgggggtttggagaatggtcttaactacata
gacctggatttggtcaaggacttcaaacagtgccctcaggagtgcacccctgaaccgcag
cctcccccacccccaccccctcatcaacccctgggcagcggtgagagcagctccacccgc
cgctcaagtgaggatttaagcgcctatgccagcatcagtttccagaagcagccagaggac
cgtcagtag

DBGET integrated database retrieval system