KEGG   Homo sapiens (human): 3670Help
Entry
3670              CDS       T01001                                 

Gene name
ISL1, ISLET1, Isl-1
Definition
(RefSeq) ISL LIM homeobox 1
  KO
K09370  
insulin gene enhancer protein ISL-1
Organism
hsa  Homo sapiens (human)
Pathway
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    3670 (ISL1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain with LIM region
    3670 (ISL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q11.1
AA seq 349 aa AA seqDB search
MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFV
RDGKTYCKRDYIRLYGIKCAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEF
ALREDGLFCRADHDVVERASLGAGDPLSPLHPARPLQMAAEPISARQPALRPHVHKQPEK
TTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRS
IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQ
SDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggagacatgggagatccaccaaaaaaaaaacgtctgatttccctatgtgttggttgc
ggcaatcagattcacgatcagtatattctgagggtttctccggatttggaatggcatgcg
gcatgtttgaaatgtgcggagtgtaatcagtatttggacgagagctgtacatgctttgtt
agggatgggaaaacctactgtaaaagagattatatcaggttgtacgggatcaaatgcgcc
aagtgcagcatcggcttcagcaagaacgacttcgtgatgcgtgcccgctccaaggtgtat
cacatcgagtgtttccgctgtgtggcctgcagccgccagctcatccctggggacgaattt
gcgcttcgggaggacggtctcttctgccgagcagaccacgatgtggtggagagggccagt
ctaggcgctggcgacccgctcagtcccctgcatccagcgcggccactgcaaatggcagcg
gagcccatctccgccaggcagccagccctgcggccccacgtccacaagcagccggagaag
accacccgcgtgcggactgtgctgaacgagaagcagctgcacaccttgcggacctgctac
gccgcaaacccgcggccagatgcgctcatgaaggagcaactggtagagatgacgggcctc
agtccccgtgtgatccgggtctggtttcaaaacaagcggtgcaaggacaagaagcgaagc
atcatgatgaagcaactccagcagcagcagcccaatgacaaaactaatatccaggggatg
acaggaactcccatggtggctgccagtccagagagacacgacggtggcttacaggctaac
ccagtggaagtacaaagttaccagccaccttggaaagtactgagcgacttcgccttgcag
agtgacatagatcagcctgcttttcagcaactggtcaatttttcagaaggaggaccgggc
tctaattccactggcagtgaagtagcatcaatgtcctctcaacttccagatacacctaac
agcatggtagccagtcctattgaggcatga

DBGET integrated database retrieval system