KEGG   Homo sapiens (human): 3673Help
Entry
3673              CDS       T01001                                 

Gene name
ITGA2, BR, CD49B, GPIa, HPA-5, VLA-2, VLAA2
Definition
integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
Orthology
K06481  
integrin alpha 2
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Platelet activation
Hematopoietic cell lineage
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Small cell lung cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3673 (ITGA2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3673 (ITGA2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3673 (ITGA2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    3673 (ITGA2)
  Cellular commiunity
   04510 Focal adhesion
    3673 (ITGA2)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3673 (ITGA2)
   04611 Platelet activation
    3673 (ITGA2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3673 (ITGA2)
   05205 Proteoglycans in cancer
    3673 (ITGA2)
   05222 Small cell lung cancer
    3673 (ITGA2)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3673 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3673 (ITGA2)
   05414 Dilated cardiomyopathy (DCM)
    3673 (ITGA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   3673 (ITGA2)
  Exosomal proteins of bladder cancer cells
   3673 (ITGA2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     VLA-2 Cell adhesion molecules (CAMs)
      3673 (ITGA2)
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type I classic cadherins
    CDHE, CDH1; cadherin 1, type 1, E-cadherin [KO:K05689]
      3673 (ITGA2)
Cellular antigens [BR:hsa04090]
 Proteins
  3673 (ITGA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q11.2
AA seq 1181 aa AA seqDB search
MGPERTGAAPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKG
NWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLILT
RNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPATQPCPSLIDVVVVCD
ESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATS
QTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCN
HDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQ
IFSIEGTVQGGDNFQMEMSQVGFSADYSSQNDILMLGAVGAFGWSGTIVQKTSHGHLIFP
KQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNITVIQ
AHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMSDLKKEEGRVYLFTIKEGILGQH
QFLEGPEGIENTRFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTIRTKY
SQKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADVAIEAS
FTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKEN
NERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKV
FSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTG
IVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQ
NLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSI
VHSFEDVGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCN
ADINPLKIGQTSSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIW
NGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSII
AGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS
NT seq 3546 nt NT seq  +upstreamnt  +downstreamnt
atggggccagaacggacaggggccgcgccgctgccgctgctgctggtgttagcgctcagt
caaggcattttaaattgttgtttggcctacaatgttggtctcccagaagcaaaaatattt
tccggtccttcaagtgaacagtttggctatgcagtgcagcagtttataaatccaaaaggc
aactggttactggttggttcaccctggagtggctttcctgagaaccgaatgggagatgtg
tataaatgtcctgttgacctatccactgccacatgtgaaaaactaaatttgcaaacttca
acaagcattccaaatgttactgagatgaaaaccaacatgagcctcggcttgatcctcacc
aggaacatgggaactggaggttttctcacatgtggtcctctgtgggcacagcaatgtggg
aatcagtattacacaacgggtgtgtgttctgacatcagtcctgattttcagctctcagcc
agcttctcacctgcaactcagccctgcccttccctcatagatgttgtggttgtgtgtgat
gaatcaaatagtatttatccttgggatgcagtaaagaattttttggaaaaatttgtacaa
ggcctggatataggccccacaaagacacaggtggggttaattcagtatgccaataatcca
agagttgtgtttaacttgaacacatataaaaccaaagaagaaatgattgtagcaacatcc
cagacatcccaatatggtggggacctcacaaacacattcggagcaattcaatatgcaaga
aaatatgcttattcagcagcttctggtgggcgacgaagtgctacgaaagtaatggtagtt
gtaactgacggtgaatcacatgatggttcaatgttgaaagctgtgattgatcaatgcaac
catgacaatatactgaggtttggcatagcagttcttgggtacttaaacagaaacgccctt
gatactaaaaatttaataaaagaaataaaagcaatcgctagtattccaacagaaagatac
tttttcaatgtgtctgatgaagcagctctactagaaaaggctgggacattaggagaacaa
attttcagcattgaaggtactgttcaaggaggagacaactttcagatggaaatgtcacaa
gtgggattcagtgcagattactcttctcaaaatgatattctgatgctgggtgcagtggga
gcttttggctggagtgggaccattgtccagaagacatctcatggccatttgatctttcct
aaacaagcctttgaccaaattctgcaggacagaaatcacagttcatatttaggttactct
gtggctgcaatttctactggagaaagcactcactttgttgctggtgctcctcgggcaaat
tataccggccagatagtgctatatagtgtgaatgagaatggcaatatcacggttattcag
gctcaccgaggtgaccagattggctcctattttggtagtgtgctgtgttcagttgatgtg
gataaagacaccattacagacgtgctcttggtaggtgcaccaatgtacatgagtgaccta
aagaaagaggaaggaagagtctacctgtttactatcaaagagggcattttgggtcagcac
caatttcttgaaggccccgagggcattgaaaacactcgatttggttcagcaattgcagct
ctttcagacatcaacatggatggctttaatgatgtgattgttggttcaccactagaaaat
cagaattctggagctgtatacatttacaatggtcatcagggcactatccgcacaaagtat
tcccagaaaatcttgggatccgatggagcctttaggagccatctccagtactttgggagg
tccttggatggctatggagatttaaatggggattccatcaccgatgtgtctattggtgcc
tttggacaagtggttcaactctggtcacaaagtattgctgatgtagctatagaagcttca
ttcacaccagaaaaaatcactttggtcaacaagaatgctcagataattctcaaactctgc
ttcagtgcaaagttcagacctactaagcaaaacaatcaagtggccattgtatataacatc
acacttgatgcagatggattttcatccagagtaacctccagggggttatttaaagaaaac
aatgaaaggtgcctgcagaagaatatggtagtaaatcaagcacagagttgccccgagcac
atcatttatatacaggagccctctgatgttgtcaactctttggatttgcgtgtggacatc
agtctggaaaaccctggcactagccctgcccttgaagcctattctgagactgccaaggtc
ttcagtattcctttccacaaagactgtggtgaggacggactttgcatttctgatctagtc
ctagatgtccgacaaataccagctgctcaagaacaaccctttattgtcagcaaccaaaac
aaaaggttaacattttcagtaacgctgaaaaataaaagggaaagtgcatacaacactgga
attgttgttgatttttcagaaaacttgttttttgcatcattctccctgccggttgatggg
acagaagtaacatgccaggtggctgcatctcagaagtctgttgcctgcgatgtaggctac
cctgctttaaagagagaacaacaggtgacttttactattaactttgacttcaatcttcaa
aaccttcagaatcaggcgtctctcagtttccaagccttaagtgaaagccaagaagaaaac
aaggctgataatttggtcaacctcaaaattcctctcctgtatgatgctgaaattcactta
acaagatctaccaacataaatttttatgaaatctcttcggatgggaatgttccttcaatc
gtgcacagttttgaagatgttggtccaaaattcatcttctccctgaaggtaacaacagga
agtgttccagtaagcatggcaactgtaatcatccacatccctcagtataccaaagaaaag
aacccactgatgtacctaactggggtgcaaacagacaaggctggtgacatcagttgtaat
gcagatatcaatccactgaaaataggacaaacatcttcttctgtatctttcaaaagtgaa
aatttcaggcacaccaaagaattgaactgcagaactgcttcctgtagtaatgttacctgc
tggttgaaagacgttcacatgaaaggagaatactttgttaatgtgactaccagaatttgg
aacgggactttcgcatcatcaacgttccagacagtacagctaacggcagctgcagaaatc
aacacctataaccctgagatatatgtgattgaagataacactgttacgattcccctgatg
ataatgaaacctgatgagaaagccgaagtaccaacaggagttataataggaagtataatt
gctggaatccttttgctgttagctctggttgcaattttatggaagctcggcttcttcaaa
agaaaatatgaaaagatgaccaaaaatccagatgagattgatgagaccacagagctcagt
agctga

DBGET integrated database retrieval system