KEGG   Homo sapiens (human): 3673Help
Entry
3673              CDS       T01001                                 

Gene name
ITGA2, BR, CD49B, GPIa, HPA-5, VLA-2, VLAA2
Definition
integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
Orthology
K06481  
integrin alpha 2
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Hematopoietic cell lineage
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Small cell lung cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:hsa05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q11.2
AA seq 1181 aa AA seqDB search
MGPERTGAAPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKG
NWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLILT
RNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPATQPCPSLIDVVVVCD
ESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATS
QTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCN
HDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQ
IFSIEGTVQGGDNFQMEMSQVGFSADYSSQNDILMLGAVGAFGWSGTIVQKTSHGHLIFP
KQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNITVIQ
AHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMSDLKKEEGRVYLFTIKEGILGQH
QFLEGPEGIENTRFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTIRTKY
SQKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADVAIEAS
FTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKEN
NERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKV
FSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTG
IVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQ
NLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSI
VHSFEDVGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCN
ADINPLKIGQTSSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIW
NGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSII
AGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS
NT seq 3546 nt NT seq  +upstreamnt  +downstreamnt
atggggccagaacggacaggggccgcgccgctgccgctgctgctggtgttagcgctcagt
caaggcattttaaattgttgtttggcctacaatgttggtctcccagaagcaaaaatattt
tccggtccttcaagtgaacagtttggctatgcagtgcagcagtttataaatccaaaaggc
aactggttactggttggttcaccctggagtggctttcctgagaaccgaatgggagatgtg
tataaatgtcctgttgacctatccactgccacatgtgaaaaactaaatttgcaaacttca
acaagcattccaaatgttactgagatgaaaaccaacatgagcctcggcttgatcctcacc
aggaacatgggaactggaggttttctcacatgtggtcctctgtgggcacagcaatgtggg
aatcagtattacacaacgggtgtgtgttctgacatcagtcctgattttcagctctcagcc
agcttctcacctgcaactcagccctgcccttccctcatagatgttgtggttgtgtgtgat
gaatcaaatagtatttatccttgggatgcagtaaagaattttttggaaaaatttgtacaa
ggcctggatataggccccacaaagacacaggtggggttaattcagtatgccaataatcca
agagttgtgtttaacttgaacacatataaaaccaaagaagaaatgattgtagcaacatcc
cagacatcccaatatggtggggacctcacaaacacattcggagcaattcaatatgcaaga
aaatatgcttattcagcagcttctggtgggcgacgaagtgctacgaaagtaatggtagtt
gtaactgacggtgaatcacatgatggttcaatgttgaaagctgtgattgatcaatgcaac
catgacaatatactgaggtttggcatagcagttcttgggtacttaaacagaaacgccctt
gatactaaaaatttaataaaagaaataaaagcaatcgctagtattccaacagaaagatac
tttttcaatgtgtctgatgaagcagctctactagaaaaggctgggacattaggagaacaa
attttcagcattgaaggtactgttcaaggaggagacaactttcagatggaaatgtcacaa
gtgggattcagtgcagattactcttctcaaaatgatattctgatgctgggtgcagtggga
gcttttggctggagtgggaccattgtccagaagacatctcatggccatttgatctttcct
aaacaagcctttgaccaaattctgcaggacagaaatcacagttcatatttaggttactct
gtggctgcaatttctactggagaaagcactcactttgttgctggtgctcctcgggcaaat
tataccggccagatagtgctatatagtgtgaatgagaatggcaatatcacggttattcag
gctcaccgaggtgaccagattggctcctattttggtagtgtgctgtgttcagttgatgtg
gataaagacaccattacagacgtgctcttggtaggtgcaccaatgtacatgagtgaccta
aagaaagaggaaggaagagtctacctgtttactatcaaagagggcattttgggtcagcac
caatttcttgaaggccccgagggcattgaaaacactcgatttggttcagcaattgcagct
ctttcagacatcaacatggatggctttaatgatgtgattgttggttcaccactagaaaat
cagaattctggagctgtatacatttacaatggtcatcagggcactatccgcacaaagtat
tcccagaaaatcttgggatccgatggagcctttaggagccatctccagtactttgggagg
tccttggatggctatggagatttaaatggggattccatcaccgatgtgtctattggtgcc
tttggacaagtggttcaactctggtcacaaagtattgctgatgtagctatagaagcttca
ttcacaccagaaaaaatcactttggtcaacaagaatgctcagataattctcaaactctgc
ttcagtgcaaagttcagacctactaagcaaaacaatcaagtggccattgtatataacatc
acacttgatgcagatggattttcatccagagtaacctccagggggttatttaaagaaaac
aatgaaaggtgcctgcagaagaatatggtagtaaatcaagcacagagttgccccgagcac
atcatttatatacaggagccctctgatgttgtcaactctttggatttgcgtgtggacatc
agtctggaaaaccctggcactagccctgcccttgaagcctattctgagactgccaaggtc
ttcagtattcctttccacaaagactgtggtgaggacggactttgcatttctgatctagtc
ctagatgtccgacaaataccagctgctcaagaacaaccctttattgtcagcaaccaaaac
aaaaggttaacattttcagtaacgctgaaaaataaaagggaaagtgcatacaacactgga
attgttgttgatttttcagaaaacttgttttttgcatcattctccctgccggttgatggg
acagaagtaacatgccaggtggctgcatctcagaagtctgttgcctgcgatgtaggctac
cctgctttaaagagagaacaacaggtgacttttactattaactttgacttcaatcttcaa
aaccttcagaatcaggcgtctctcagtttccaagccttaagtgaaagccaagaagaaaac
aaggctgataatttggtcaacctcaaaattcctctcctgtatgatgctgaaattcactta
acaagatctaccaacataaatttttatgaaatctcttcggatgggaatgttccttcaatc
gtgcacagttttgaagatgttggtccaaaattcatcttctccctgaaggtaacaacagga
agtgttccagtaagcatggcaactgtaatcatccacatccctcagtataccaaagaaaag
aacccactgatgtacctaactggggtgcaaacagacaaggctggtgacatcagttgtaat
gcagatatcaatccactgaaaataggacaaacatcttcttctgtatctttcaaaagtgaa
aatttcaggcacaccaaagaattgaactgcagaactgcttcctgtagtaatgttacctgc
tggttgaaagacgttcacatgaaaggagaatactttgttaatgtgactaccagaatttgg
aacgggactttcgcatcatcaacgttccagacagtacagctaacggcagctgcagaaatc
aacacctataaccctgagatatatgtgattgaagataacactgttacgattcccctgatg
ataatgaaacctgatgagaaagccgaagtaccaacaggagttataataggaagtataatt
gctggaatccttttgctgttagctctggttgcaattttatggaagctcggcttcttcaaa
agaaaatatgaaaagatgaccaaaaatccagatgagattgatgagaccacagagctcagt
agctga

DBGET integrated database retrieval system