KEGG   Homo sapiens (human): 3674Help
Entry
3674              CDS       T01001                                 

Gene name
ITGA2B, BDPLT16, BDPLT2, CD41, CD41B, GP2B, GPIIb, GT, GTA, HPA3
Definition
integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
Orthology
K06476  
integrin alpha 2B
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Platelet activation
Hematopoietic cell lineage
Regulation of actin cytoskeleton
Pathways in cancer
Small cell lung cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Disease
H00226  
Glanzmann thrombasthenia
Drug target
Abciximab: 
Eptifibatide: 
Tirofiban: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    3674 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    3674 (ITGA2B)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3674 (ITGA2B)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    3674 (ITGA2B)
  Cell communication
   04510 Focal adhesion
    3674 (ITGA2B)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3674 (ITGA2B)
   04611 Platelet activation
    3674 (ITGA2B)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3674 (ITGA2B)
   05222 Small cell lung cancer
    3674 (ITGA2B)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3674 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3674 (ITGA2B)
   05414 Dilated cardiomyopathy (DCM)
    3674 (ITGA2B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     3674 (ITGA2B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3674 (ITGA2B)
Cell adhesion molecules and their ligands [BR:hsa04516]
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type II classic cadherins
    CDH6; cadherin 6, type 2, K-cadherin [KO:K06798]
     alpha IIb  beta 3 Cell adhesion molecules (CAMs)
      3674 (ITGA2B)
Cellular antigens [BR:hsa04090]
 Proteins
  3674 (ITGA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.32
AA seq 1039 aa AA seqDB search
MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDS
HGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKA
RQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGN
TLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRP
GILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEI
LDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVY
LFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQV
LVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYR
AQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQ
LDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSL
NVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADN
VLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCEL
GNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVE
LRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQP
SDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQP
SRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAW
FNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWK
VGFFKRNRPPLEEDDEEGE
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atggccagagctttgtgtccactgcaagccctctggcttctggagtgggtgctgctgctc
ttgggaccttgtgctgcccctccagcctgggccttgaacctggacccagtgcagctcacc
ttctatgcaggccccaatggcagccagtttggattttcactggacttccacaaggacagc
catgggagagtggccatcgtggtgggcgccccgcggaccctgggccccagccaggaggag
acgggcggcgtgttcctgtgcccctggagggccgagggcggccagtgcccctcgctgctc
tttgacctccgtgatgagacccgaaatgtaggctcccaaactttacaaaccttcaaggcc
cgccaaggactgggggcgtcggtcgtcagctggagcgacgtcattgtggcctgcgccccc
tggcagcactggaacgtcctagaaaagactgaggaggctgagaagacgcccgtaggtagc
tgctttttggctcagccagagagcggccgccgcgccgagtactccccctgtcgcgggaac
accctgagccgcatttacgtggaaaatgattttagctgggacaagcgttactgtgaagcg
ggcttcagctccgtggtcactcaggccggagagctggtgcttggggctcctggcggctat
tatttcttaggtctcctggcccaggctccagttgcggatattttctcgagttaccgccca
ggcatccttttgtggcacgtgtcctcccagagcctctcctttgactccagcaacccagag
tacttcgacggctactgggggtactcggtggccgtgggcgagttcgacggggatctcaac
actacagaatatgtcgtcggtgcccccacttggagctggaccctgggagcggtggaaatt
ttggattcctactaccagaggctgcatcggctgcgcggagagcagatggcgtcgtatttt
gggcattcagtggctgtcactgacgtcaacggggatgggaggcatgatctgctggtgggc
gctccactgtatatggagagccgggcagaccgaaaactggccgaagtggggcgtgtgtat
ttgttcctgcagccgcgaggcccccacgcgctgggtgcccccagcctcctgctgactggc
acacagctctatgggcgattcggctctgccatcgcacccctgggcgacctcgaccgggat
ggctacaatgacattgcagtggctgccccctacgggggtcccagtggccggggccaagtg
ctggtgttcctgggtcagagtgaggggctgaggtcacgtccctcccaggtcctggacagc
cccttccccacaggctctgcctttggcttctcccttcgaggtgccgtagacatcgatgac
aacggatacccagacctgatcgtgggagcttacggggccaaccaggtggctgtgtacaga
gctcagccagtggtgaaggcctctgtccagctactggtgcaagattcactgaatcctgct
gtgaagagctgtgtcctacctcagaccaagacacccgtgagctgcttcaacatccagatg
tgtgttggagccactgggcacaacattcctcagaagctatccctaaatgccgagctgcag
ctggaccggcagaagccccgccagggccggcgggtgctgctgctgggctctcaacaggca
ggcaccaccctgaacctggatctgggcggaaagcacagccccatctgccacaccaccatg
gccttccttcgagatgaggcagacttccgggacaagctgagccccattgtgctcagcctc
aatgtgtccctaccgcccacggaggctggaatggcccctgctgtcgtgctgcatggagac
acccatgtgcaggagcagacacgaatcgtcctggactgtggggaagatgacgtatgtgtg
ccccagcttcagctcactgccagcgtgacgggctccccgctcctagttggggcagataat
gtcctggagctgcagatggacgcagccaacgagggcgagggggcctatgaagcagagctg
gccgtgcacctgccccagggcgcccactacatgcgggccctaagcaatgtcgagggcttt
gagagactcatctgtaatcagaagaaggagaatgagaccagggtggtgctgtgtgagctg
ggcaaccccatgaagaagaacgcccagataggaatcgcgatgttggtgagcgtggggaat
ctggaagaggctggggagtctgtgtccttccagctgcagatacggagcaagaacagccag
aatccaaacagcaagattgtgctgctggacgtgccggtccgggcagaggcccaagtggag
ctgcgagggaactcctttccagcctccctggtggtggcagcagaagaaggtgagagggag
cagaacagcttggacagctggggacccaaagtggagcacacctatgagctccacaacaat
ggccctgggactgtgaatggtcttcacctcagcatccaccttccgggacagtcccagccc
tccgacctgctctacatcctggatatacagccccaggggggccttcagtgcttcccacag
cctcctgtcaaccctctcaaggtggactgggggctgcccatccccagcccctcccccatt
cacccggcccatcacaagcgggatcgcagacagatcttcctgccagagcccgagcagccc
tcgaggcttcaggatccagttctcgtaagctgcgactcggcgccctgtactgtggtgcag
tgtgacctgcaggagatggcgcgcgggcagcgggccatggtcacggtgctggccttcctg
tggctgcccagcctctaccagaggcctctggatcagtttgtgctgcagtcgcacgcatgg
ttcaacgtgtcctccctcccctatgcggtgcccccgctcagcctgccccgaggggaagct
caggtgtggacacagctgctccgggccttggaggagagggccattccaatctggtgggtg
ctggtgggtgtgctgggtggcctgctgctgctcaccatcctggtcctggccatgtggaag
gtcggcttcttcaagcggaaccggccacccctggaagaagatgatgaagagggggagtga

DBGET integrated database retrieval system