KEGG   Homo sapiens (human): 3675Help
Entry
3675              CDS       T01001                                 

Gene name
ITGA3, CD49C, GAP-B3, GAPB3, ILNEB, MSK18, VCA-2, VL3A, VLA3a
Definition
integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor)
Orthology
K06482  
integrin alpha 3
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Hematopoietic cell lineage
Regulation of actin cytoskeleton
Pathways in cancer
Small cell lung cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3675 (ITGA3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3675 (ITGA3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    3675 (ITGA3)
  Cellular commiunity
   04510 Focal adhesion
    3675 (ITGA3)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3675 (ITGA3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3675 (ITGA3)
   05222 Small cell lung cancer
    3675 (ITGA3)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3675 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3675 (ITGA3)
   05414 Dilated cardiomyopathy (DCM)
    3675 (ITGA3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3675 (ITGA3)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-2
    ITGB1; integrin beta 1 [KO:K05719]
     VLA-3 Cell adhesion molecules (CAMs)
      3675 (ITGA3)
   VLA-3
      3675 (ITGA3)
Cellular antigens [BR:hsa04090]
 Proteins
  3675 (ITGA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.33
AA seq 1051 aa AA seqDB search
MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHR
QTERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTY
HNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYK
DPEDQGNLYIGYTMQVGSFILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEG
SQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAGTSFPAHPSLL
LHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGE
KLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVPRPAVL
DPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFH
GFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQA
QALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNT
RTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAF
EVIGVTLHTRDLQVQLQLSTSSHQDNLWPMILTLLVDYTLQTSLSMVNHRLQSFFGGTVM
GESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHG
NGSWPCRPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSET
VLTCATGRAHCVWLECPIPDAPVVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRT
SIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFK
RARTRALYEAKRQKAEMKSQPSETERLTDDY
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgggccccggccccagccgcgcgccccgcgccccacgcctgatgctctgtgcgctcgcc
ttgatggtggcggccggcggctgcgtcgtctccgccttcaacctggatacccgattcctg
gtagtgaaggaggccgggaacccgggcagcctcttcggctactcggtcgccctccatcgg
cagacagagcggcagcagcgctacctgctcctggctggtgccccccgggagctcgctgtg
cccgatggctacaccaaccggactggtgctgtgtacctgtgcccactcactgcccacaag
gatgactgtgagcggatgaacatcacagtgaaaaatgaccctggccatcacattattgag
gacatgtggcttggagtgactgtggccagccagggccctgcaggcagagttctggtctgt
gcccaccgctacacccaggtgctgtggtcagggtcagaagaccagcggcgcatggtgggc
aagtgctacgtgcgaggcaatgacctagagctggactccagtgatgactggcagacctac
cacaacgagatgtgcaatagcaacacagactacctggagacgggcatgtgccagctgggc
accagcggtggcttcacccagaacactgtgtacttcggcgcccccggtgcctacaactgg
aaaggaaacagctacatgattcagcgcaaggagtgggacttatctgagtatagttacaag
gacccagaggaccaaggaaacctctatattgggtacacgatgcaggtaggcagcttcatc
ctgcaccccaaaaacatcaccattgtgacaggtgccccacggcaccgacatatgggcgcg
gtgttcttgctgagccaggaggcaggcggagacctgcggaggaggcaggtgctggagggc
tcgcaggtgggcgcctattttggcagcgccattgccctggcagacctgaacaatgatggg
tggcaggacctcctggtgggcgccccctactacttcgagaggaaagaggaagtagggggt
gccatctatgtcttcatgaaccaggcgggaacctccttccctgctcacccctcactcctt
cttcatggccccagtggctctgcctttggtttatctgtggccagcattggtgacatcaac
caggatggatttcaggatattgctgtgggagctccgtttgaaggcttgggcaaagtgtac
atctatcacagtagctctaaggggctccttagacagccccagcaggtaatccatggagag
aagctgggactgcctgggttggccaccttcggctattccctcagtgggcagatggatgtg
gatgagaacttctacccagaccttctagtgggaagcctgtcagaccacattgtgctgctg
cgggcccggcccgtcatcaacatcgtccacaagaccttggtgcccaggccagctgtgctg
gaccctgcactttgcacggccacctcttgtgtgcaagtggagctgtgctttgcttacaac
cagagtgccgggaaccccaactacaggcgaaacatcaccctggcctacactctggaggct
gacagggaccgccggccgccccggctccgctttgccggcagtgagtccgctgtcttccac
ggcttcttctccatgcccgagatgcgctgccagaagctggagctgctcctgatggacaac
ctccgtgacaaactccgccccatcatcatctccatgaactactctttacctttgcggatg
cccgatcgcccccggctggggctgcggtccctggacgcctacccgatcctcaaccaggca
caggctctggagaaccacactgaggtccagttccagaaggagtgcgggcctgacaacaag
tgtgagagcaacttgcagatgcgggcagccttcgtgtcagagcagcagcagaagctgagc
aggctccagtacagcagagacgtccggaaattgctcctgagcatcaacgtgacgaacacc
cggacctcggagcgctccggggaggacgcccacgaggcgctgctcaccctggtggtgcct
cccgccctgctgctgtcctcagtgcgcccccccggggcctgccaagctaatgagaccatc
ttttgcgagctggggaaccccttcaaacggaaccagaggatggagctgctcatcgccttt
gaggtcatcggggtgaccctgcacacaagggaccttcaggtgcagctgcagctctccacg
tcgagtcaccaggacaacctgtggcccatgatcctcactctgctggtggactatacactc
cagacctcgcttagcatggtaaatcaccggctacaaagcttctttggggggacagtgatg
ggtgagtctggcatgaaaactgtggaggatgtaggaagccccctcaagtatgaattccag
gtgggcccaatgggggaggggctggtgggcctggggaccctggtcctaggtctggagtgg
ccctacgaagtcagcaatggcaagtggctgctgtatcccacggagatcaccgtccatggc
aatgggtcctggccctgccgaccacctggagaccttatcaaccctctcaacctcactctt
tctgaccctggggacaggccatcatccccacagcgcaggcggcgacagctggatccaggg
ggaggccagggccccccacctgtcactctggctgctgccaaaaaagccaagtctgagact
gtgctgacctgtgccacagggcgtgcccactgtgtgtggctagagtgccccatccctgat
gcccccgttgtcaccaacgtgactgtgaaggcacgagtgtggaacagcaccttcatcgag
gattacagagactttgaccgagtccgggtaaatggctgggctaccctattcctccgaacc
agcatccccaccatcaacatggagaacaagaccacgtggttctctgtggacattgactcg
gagctggtggaggagctgccggccgaaatcgagctgtggctggtgctggtggccgtgggt
gcagggctgctgctgctggggctgatcatcctcctgctgtggaagtgcggcttcttcaag
cgagcccgcactcgcgccctgtatgaagctaagaggcagaaggcggagatgaagagccag
ccgtcagagacagagaggctgaccgacgactactga

DBGET integrated database retrieval system