KEGG   Homo sapiens (human): 3679Help
Entry
3679              CDS       T01001                                 

Gene name
ITGA7
Definition
integrin, alpha 7
Orthology
K06583  
integrin alpha 7
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Disease
H00590  
Congenital muscular dystrophies (CMD/MDC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3679 (ITGA7)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3679 (ITGA7)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    3679 (ITGA7)
  Cell communication
   04510 Focal adhesion
    3679 (ITGA7)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3679 (ITGA7)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3679 (ITGA7)
   05414 Dilated cardiomyopathy (DCM)
    3679 (ITGA7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3679 (ITGA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13
AA seq 1141 aa AA seqDB search
MAGARSRDPWGASGICYLFGSLLVELLFSRAVAFNLDVMGALRKEGEPGSLFGFSVALHR
QLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADMQKESKE
NQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGE
WKFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWKGTARVELCAQGSADLAH
LDDGPYEAGGEKEQDPRLIPVPANSYFGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVI
LRKDSASRLVPEVMLSGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVY
VYLNQGGHWAGISPLRLCGSPDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHG
SSLGVVAKPSQVLEGEAVGIKSFGYSLSGSLDMDGNQYPDLLVGSLADTAVLFRARPILH
VSHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRL
RGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQLQENVKDKLRAIVVTLSYS
LQTPRLRRQAPGQGLPPVAPILNAHQPSTQRAEIHFLKQGCGEDKICQSNLQLVRARFCT
RVSDTEFQPLPMDVDGTTALFALSGQPVIGLELMVTNLPSDPAQPQADGDDAHEAQLLVM
LPDSLHYSGVRALDPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLILSTSGISIETT
ELEVELLLATISEQELHPVSARARVFIELPLSIAGMAIPQQLFFSGVVRGERAMQSERDV
GSKVKYEVTVSNQGQSLRTLGSAFLNIMWPHEIANGKWLLYPMQVELEGGQGPGQKGLCS
PRPNILHLDVDSRDRRRRELEPPEQQEPGERQEPSMSWWPVSSAEKKKNITLDCARGTAN
CVVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKSSIKNLMLRDA
STVIPVMVYLDPMAVVAEGVPWWVILLAVLAGLLVLALLVLLLWKMGFFKRAKHPEATVP
QYHAVKIPREDRQQFKEEKTGTILRNNWGSPRREGPDAHPILAADGHPELGPDGHPGPGT
A
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atggccggggctcggagccgcgacccttggggggcctccgggatttgctacctttttggc
tccctgctcgtcgaactgctcttctcacgggctgtcgccttcaatctggacgtgatgggt
gccttgcgcaaggagggcgagccaggcagcctcttcggcttctctgtggccctgcaccgg
cagttgcagccccgaccccagagctggctgctggtgggtgctccccaggccctggctctt
cctgggcagcaggcgaatcgcactggaggcctcttcgcttgcccgttgagcctggaggag
actgactgctacagagtggacatcgaccagggagctgatatgcaaaaggaaagcaaggag
aaccagtggttgggagtcagtgttcggagccaggggcctgggggcaagattgttacctgt
gcacaccgatatgaggcaaggcagcgagtggaccagatcctggagacgcgggatatgatt
ggtcgctgctttgtgctcagccaggacctggccatccgggatgagttggatggtggggaa
tggaagttctgtgagggacgcccccaaggccatgaacaatttgggttctgccagcagggc
acagctgccgccttctcccctgatagccactacctcctctttggggccccaggaacctat
aattggaagggcacggccagggtggagctctgtgcacagggctcagcggacctggcacac
ctggacgacggtccctacgaggcggggggagagaaggagcaggacccccgcctcatcccg
gtccctgccaacagctactttggcttctctattgactcggggaaaggtctggtgcgtgca
gaagagctgagctttgtggctggagccccccgcgccaaccacaagggtgctgtggtcatc
ctgcgcaaggacagcgccagtcgcctggtgcccgaggttatgctgtctggggagcgcctg
acctccggctttggctactcactggctgtggctgacctcaacagtgatggctggccagac
ctgatagtgggtgccccctacttctttgagcgccaagaagagctggggggtgctgtgtat
gtgtacttgaaccaggggggtcactgggctgggatctcccctctccggctctgcggctcc
cctgactccatgttcgggatcagcctggctgtcctgggggacctcaaccaagatggcttt
ccagatattgcagtgggtgccccctttgatggtgatgggaaagtcttcatctaccatggg
agcagcctgggggttgtcgccaaaccttcacaggtgctggagggcgaggctgtgggcatc
aagagcttcggctactccctgtcaggcagcttggatatggatgggaaccaataccctgac
ctgctggtgggctccctggctgacaccgcagtgctcttcagggccagacccatcctccat
gtctcccatgaggtctctattgctccacgaagcatcgacctggagcagcccaactgtgct
ggcggccactcggtctgtgtggacctaagggtctgtttcagctacattgcagtccccagc
agctatagccctactgtggccctggactatgtgttagatgcggacacagaccggaggctc
cggggccaggttccccgtgtgacgttcctgagccgtaacctggaagaacccaagcaccag
gcctcgggcaccgtgtggctgaagcaccagcatgaccgagtctgtggagacgccatgttc
cagctccaggaaaatgtcaaagacaagcttcgggccattgtagtgaccttgtcctacagt
ctccagacccctcggctccggcgacaggctcctggccaggggctgcctccagtggccccc
atcctcaatgcccaccagcccagcacccagcgggcagagatccacttcctgaagcaaggc
tgtggtgaagacaagatctgccagagcaatctgcagctggtccgcgcccgcttctgtacc
cgggtcagcgacacggaattccaacctctgcccatggatgtggatggaacaacagccctg
tttgcactgagtgggcagccagtcattggcctggagctgatggtcaccaacctgccatcg
gacccagcccagccccaggctgatggggatgatgcccatgaagcccagctcctggtcatg
cttcctgactcactgcactactcaggggtccgggccctggaccctgcggagaagccactc
tgcctgtccaatgagaatgcctcccatgttgagtgtgagctggggaaccccatgaagaga
ggtgcccaggtcaccttctacctcatccttagcacctccgggatcagcattgagaccacg
gaactggaggtagagctgctgttggccacgatcagtgagcaggagctgcatccagtctct
gcacgagcccgtgtcttcattgagctgccactgtccattgcaggaatggccattccccag
caactcttcttctctggtgtggtgaggggcgagagagccatgcagtctgagcgggatgtg
ggcagcaaggtcaagtatgaggtcacggtttccaaccaaggccagtcgctcagaaccctg
ggctctgccttcctcaacatcatgtggcctcatgagattgccaatgggaagtggttgctg
tacccaatgcaggttgagctggagggcgggcaggggcctgggcagaaagggctttgctct
cccaggcccaacatcctccacctggatgtggacagtagggataggaggcggcgggagctg
gagccacctgagcagcaggagcctggtgagcggcaggagcccagcatgtcctggtggcca
gtgtcctctgctgagaagaagaaaaacatcaccctggactgcgcccggggcacggccaac
tgtgtggtgttcagctgcccactctacagctttgaccgcgcggctgtgctgcatgtctgg
ggccgtctctggaacagcacctttctggaggagtactcagctgtgaagtccctggaagtg
attgtccgggccaacatcacagtgaagtcctccataaagaacttgatgctccgagatgcc
tccacagtgatcccagtgatggtatacttggaccccatggctgtggtggcagaaggagtg
ccctggtgggtcatcctcctggctgtactggctgggctgctggtgctagcactgctggtg
ctgctcctgtggaagatgggattcttcaaacgggcgaagcaccccgaggccaccgtgccc
cagtaccatgcggtgaagattcctcgggaagaccgacagcagttcaaggaggagaagacg
ggcaccatcctgaggaacaactggggcagcccccggcgggagggcccggatgcacacccc
atcctggctgctgacgggcatcccgagctgggccccgatgggcatccagggccaggcacc
gcctag

DBGET integrated database retrieval system