KEGG   Homo sapiens (human): 368Help
Entry
368               CDS       T01001                                 

Gene name
ABCC6, ABC34, ARA, EST349056, GACI2, MLP1, MOAT-E, MOATE, MRP6, PXE, PXE1, URG7
Definition
(RefSeq) ATP binding cassette subfamily C member 6
  KO
K05669  
ATP-binding cassette, subfamily C (CFTR/MRP), member 6
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Disease
H00560  
Pseudoxanthoma elasticum
H01002  
Generalized arterial calcification of infancy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    368 (ABCC6)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    368 (ABCC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.1
AA seq 1503 aa AA seqDB search
MAAPAEPCAGQGVWNQTEPEPAATSLLSLCFLRTAGVWVPPMYLWVLGPIYLLFIHHHGR
GYLRMSPLFKAKMVLGFALIVLCTSSVAVALWKIQQGTPEAPEFLIHPTVWLTTMSFAVF
LIHTERKKGVQSSGVLFGYWLLCFVLPATNAAQQASGAGFQSDPVRHLSTYLCLSLVVAQ
FVLSCLADQPPFFPEDPQQSNPCPETGAAFPSKATFWWVSGLVWRGYRRPLRPKDLWSLG
RENSSEELVSRLEKEWMRNRSAARRHNKAIAFKRKGGSGMKAPETEPFLRQEGSQWRPLL
KAIWQVFHSTFLLGTLSLIISDVFRFTVPKLLSLFLEFIGDPKPPAWKGYLLAVLMFLSA
CLQTLFEQQNMYRLKVLQMRLRSAITGLVYRKVLALSSGSRKASAVGDVVNLVSVDVQRL
TESVLYLNGLWLPLVWIVVCFVYLWQLLGPSALTAIAVFLSLLPLNFFISKKRNHHQEEQ
MRQKDSRARLTSSILRNSKTIKFHGWEGAFLDRVLGIRGQELGALRTSGLLFSVSLVSFQ
VSTFLVALVVFAVHTLVAENAMNAEKAFVTLTVLNILNKAQAFLPFSIHSLVQARVSFDR
LVTFLCLEEVDPGVVDSSSSGSAAGKDCITIHSATFAWSQESPPCLHRINLTVPQGCLLA
VVGPVGAGKSSLLSALLGELSKVEGFVSIEGAVAYVPQEAWVQNTSVVENVCFGQELDPP
WLERVLEACALQPDVDSFPEGIHTSIGEQGMNLSGGQKQRLSLARAVYRKAAVYLLDDPL
AALDAHVGQHVFNQVIGPGGLLQGTTRILVTHALHILPQADWIIVLANGAIAEMGSYQEL
LQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRT
TSEAQTEVPLDDPDRAGWPAGKDSIQYGRVKATVHLAYLRAVGTPLCLYALFLFLCQQVA
SFCRGYWLSLWADDPAVGGQQTQAALRGGIFGLLGCLQAIGLFASMAAVLLGGARASRLL
FQRLLWDVVRSPISFFERTPIGHLLNRFSKETDTVDVDIPDKLRSLLMYAFGLLEVSLVV
AVATPLATVAILPLFLLYAGFQSLYVVSSCQLRRLESASYSSVCSHMAETFQGSTVVRAF
RTQAPFVAQNNARVDESQRISFPRLVADRWLAANVELLGNGLVFAAATCAVLSKAHLSAG
LVGFSVSAALQVTQTLQWVVRNWTDLENSIVSVERMQDYAWTPKEAPWRLPTCAAQPPWP
QGGQIEFRDFGLRYRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLRLQEAAE
GGIWIDGVPIAHVGLHTLRSRISIIPQDPILFPGSLRMNLDLLQEHSDEAIWAALETVQL
KALVASLPGQLQYKCADRGEDLSVGQKQLLCLARALLRKTQILILDEATAAVDPGTELQM
QAMLGSWFAQCTVLLIAHRLRSVMDCARVLVMDKGQVAESGSPAQLLAQKGLFYRLAQES
GLV
NT seq 4512 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcctgctgagccctgcgcggggcagggggtctggaaccagacagagcctgaa
cctgccgccaccagcctgctgagcctgtgcttcctgagaacagcaggggtctgggtaccc
cccatgtacctctgggtccttggtcccatctacctcctcttcatccaccaccatggccgg
ggctacctccggatgtccccactcttcaaagccaagatggtgcttggattcgccctcata
gtcctgtgtacctccagcgtggctgtcgctctttggaaaatccaacagggaacgcctgag
gccccagaattcctcattcatcctactgtgtggctcaccacgatgagcttcgcagtgttc
ctgattcacaccgagaggaaaaagggagtccagtcatctggagtgctgtttggttactgg
cttctctgctttgtcttgccagctaccaacgctgcccagcaggcctccggagcgggcttc
cagagcgaccctgtccgccacctgtccacctacctatgcctgtctctggtggtggcacag
tttgtgctgtcctgcctggcggatcaaccccccttcttccctgaagacccccagcagtct
aacccctgtccagagactggggcagccttcccctccaaagccacgttctggtgggtttct
ggcctggtctggaggggatacaggaggccactgagaccaaaagacctctggtcgcttggg
agagaaaactcctcagaagaacttgtttcccggcttgaaaaggagtggatgaggaaccgc
agtgcagcccggaggcacaacaaggcaatagcatttaaaaggaaaggcggcagtggcatg
aaggctccagagaccgagcccttcctacggcaagaagggagccagtggcgcccactgctg
aaggccatctggcaggtgttccattctaccttcctcctggggaccctcagcctcatcatc
agtgatgtcttcaggttcactgtccccaagctgctcagccttttcctggagtttattggt
gatcccaagcctccagcctggaagggctacctcctcgccgtgctgatgttcctctcagcc
tgcctgcaaacgctgtttgagcagcagaacatgtacaggctcaaggtgctgcagatgagg
ttgcggtcggccatcactggcctggtgtacagaaaggtcctggctctgtccagcggctcc
agaaaggccagtgcggtgggtgatgtggtcaatctggtgtccgtggacgtgcagcggctg
accgagagcgtcctctacctcaacgggctgtggctgcctctcgtctggatcgtggtctgc
ttcgtctatctctggcagctcctggggccctccgccctcactgccatcgctgtcttcctg
agcctcctccctctgaatttcttcatctccaagaaaaggaaccaccatcaggaggagcaa
atgaggcagaaggactcacgggcacggctcaccagctctatcctcaggaactcgaagacc
atcaagttccatggctgggagggagcctttctggacagagtcctgggcatccgaggccag
gagctgggcgccttgcggacctccggcctcctcttctctgtgtcgctggtgtccttccaa
gtgtctacatttctggtcgcactggtggtgtttgctgtccacactctggtggccgagaat
gctatgaatgcagagaaagcctttgtgactctcacagttctcaacatcctcaacaaggcc
caggctttcctgcccttctccatccactccctcgtccaggcccgggtgtcctttgaccgt
ctggtcaccttcctctgcctggaagaagttgaccctggtgtcgtagactcaagttcctct
ggaagcgctgccgggaaggattgcatcaccatacacagtgccaccttcgcctggtcccag
gaaagccctccctgcctccacagaataaacctcacggtgccccagggctgtctgctggct
gttgtcggtccagtgggggcagggaagtcctccctgctgtccgccctccttggggagctg
tcaaaggtggaggggttcgtgagcatcgagggtgctgtggcctacgtgccccaggaggcc
tgggtgcagaacacctctgtggtagagaatgtgtgcttcgggcaggagctggacccaccc
tggctggagagagtactagaagcctgtgccctgcagccagatgtggacagcttccctgag
ggaatccacacttcaattggggagcagggcatgaatctctccggaggccagaagcagcgg
ctgagcctggcccgggctgtatacagaaaggcagctgtgtacctgctggatgaccccctg
gcggccctggatgcccacgttggccagcatgtcttcaaccaggtcattgggcctggtggg
ctactccagggaacaacacggattctcgtgacgcacgcactccacatcctgccccaggct
gattggatcatagtgctggcaaatggggccatcgcagagatgggttcctaccaggagctt
ctgcagaggaagggggccctcgtgtgtcttctggatcaagccagacagccaggagataga
ggagaaggagaaacagaacctgggaccagcaccaaggaccccagaggcacctctgcaggc
aggaggcccgagcttagacgcgagaggtccatcaagtcagtccctgagaaggaccgtacc
acttcagaagcccagacagaggttcctctggatgaccctgacagggcaggatggccagca
ggaaaggacagcatccaatacggcagggtgaaggccacagtgcacctggcctacctgcgt
gccgtgggcacccccctctgcctctacgcactcttcctcttcctctgccagcaagtggcc
tccttctgccggggctactggctgagcctgtgggcggacgaccctgcagtaggtgggcag
cagacgcaggcagccctgcgtggcgggatcttcgggctcctcggctgtctccaagccatt
gggctgtttgcctccatggctgcggtgctcctaggtggggcccgggcatccaggttgctc
ttccagaggctcctgtgggatgtggtgcgatctcccatcagcttctttgagcggacaccc
attggtcacctgctaaaccgcttctccaaggagacagacacggttgacgtggacattcca
gacaaactccggtccctgctgatgtacgcctttggactcctggaggtcagcctggtggtg
gcagtggctaccccactggccactgtggccatcctgccactgtttctcctctacgctggg
tttcagagcctgtatgtggttagctcatgccagctgagacgcttggagtcagccagctac
tcgtctgtctgctcccacatggctgagacgttccagggcagcacagtggtccgggcattc
cgaacccaggccccctttgtggctcagaacaatgctcgcgtagatgaaagccagaggatc
agtttcccgcgactggtggctgacaggtggcttgcggccaatgtggagctcctggggaat
ggcctggtgtttgcagctgccacgtgtgctgtgctgagcaaagcccacctcagtgctggc
ctcgtgggcttctctgtctctgctgccctccaggtgacccagacactgcagtgggttgtt
cgcaactggacagacctagagaacagcatcgtgtcagtggagcggatgcaggactatgcc
tggacgcccaaggaggctccctggaggctgcccacatgtgcagctcagcccccctggcct
cagggcgggcagatcgagttccgggactttgggctaagataccgacctgagctcccgctg
gctgtgcagggcgtgtccttcaagatccacgcaggagagaaggtgggcatcgttggcagg
accggggcagggaagtcctccctggccagtgggctgctgcggctccaggaggcagctgag
ggtgggatctggatcgacggggtccccattgcccacgtggggctgcacacactgcgctcc
aggatcagcatcatcccccaggaccccatcctgttccctggctctctgcggatgaacctc
gacctgctgcaggagcactcggacgaggctatctgggcagccctggagacggtgcagctc
aaagccttggtggccagcctgcccggccagctgcagtacaagtgtgctgaccgaggcgag
gacctgagcgtgggccagaaacagctcctgtgtctggcacgtgcccttctccggaagacc
cagatcctcatcctggacgaggctactgctgccgtggaccctggcacggagctgcagatg
caggccatgctcgggagctggtttgcacagtgcactgtgctgctcattgcccaccgcctg
cgctccgtgatggactgtgcccgggttctggtcatggacaaggggcaggtggcagagagc
ggcagcccggcccagctgctggcccagaagggcctgttttacagactggcccaggagtca
ggcctggtctga

DBGET integrated database retrieval system