KEGG   Homo sapiens (human): 3680Help
Entry
3680              CDS       T01001                                 

Gene name
ITGA9, ALPHA-RLC, ITGA4L, RLC
Definition
integrin, alpha 9
Orthology
K06585  
integrin alpha 9
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Disease
H00590  
Congenital muscular dystrophies (CMD/MDC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3680 (ITGA9)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3680 (ITGA9)
   04514 Cell adhesion molecules (CAMs)
    3680 (ITGA9)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    3680 (ITGA9)
  Cell communication
   04510 Focal adhesion
    3680 (ITGA9)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3680 (ITGA9)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3680 (ITGA9)
   05414 Dilated cardiomyopathy (DCM)
    3680 (ITGA9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
3p21.3
AA seq 1035 aa AA seqDB search
MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNT
RWVLVGAPKADSKYSPSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGTSCGKTCREDR
DDEWMGVSLARQPKADGRVLACAHRWKNIYYEADHILPHGFCYIIPSNLQAKGRTLIPCY
EEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTIKVLNLTDNTYLKLNDEVIM
NRRYTYLGYAVTAGHFSHPSTIDVVGGAPQDKGIGKVYIFRADRRSGTLIKIFQASGKKM
GSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLALTGDGAY
NAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVYIYHGDAGGIVPQYSMKLSGQKIN
PVLRMFGQSISGGIDMDGNGYPDVTVGAFMSDSVVLLRARPVITVDVSIFLPGSINITAP
QCHDGQQPVNCLNVTTCFSFHGKHVPGEIGLNYVLMADVAKKEKGQMPRVYFVLLGETMG
QVTEKLQLTYMEETCRHYVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVL
RWKKGQKIAQKNQTVFERNCRSEDCAADLQLQGKLLLSSMDEKTLYLALGAVKNISLNIS
ISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKYE
FSVIFDTSHLSGEEEVLSFIVTAQSGNTERSESLHDNTLVLMVPLMHEVDTSITGIMSPT
SFVYGESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEM
FHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKPGISCLT
AHCNFSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMSRAKVKVDPALRVVEIAHGNPE
EVTVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKN
RKENEDSWDWVQKNQ
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcccggctgcgccgaggggcgccgggaggctccgcgcgctgctgctggcgctg
gtggtcgcggggatccccgcgggcgcctacaacctcgacccgcagcgccccgtgcacttc
cagggccccgctgactcgttcttcggctacgcagttctggagcatttccacgacaacacg
cgctgggtccttgtgggcgcaccaaaggcagattccaaatacagcccttcagtgaagtct
cctggggctgtgtttaagtgccgtgttcacaccaaccctgaccggagatgcaccgaactg
gacatggctcgagggaagaatcggggcacgtcctgcggaaagacctgccgggaagaccgc
gatgatgagtggatgggggtgagcctggcccgacagcccaaggctgatggccgtgtgttg
gcctgtgctcatcgctggaagaacatctactatgaagccgaccacatcctaccccatggc
ttctgctacatcatcccctccaacctccaggccaaaggcaggacgctgatcccttgctat
gaagagtataagaagaagtacggagaggaacacggctcctgccaggctgggatagcgggc
ttcttcaccgaggagctggtggtgatgggtgctccagggtcattttattgggctggaacc
atcaaagtgctgaaccttacggacaacacctatttaaaactgaacgacgaagtgatcatg
aacaggcggtacacctacctgggctacgcagtgaccgctggccacttctctcacccgtcc
accattgatgtggtaggaggtgccccacaggacaaaggcatcggcaaggtttatattttc
agagctgaccgaagatcaggcaccttaattaagatctttcaagcatcaggtaaaaagatg
ggctcttacttcggctcctccttgtgcgcagttgacctgaatggggacggcctctctgac
ctgctggtgggggcccccatgttttctgagatcagggatgagggacaggtcactgtctac
atcaacagaggaaatggagccctcgaggagcagctggctctgactggggatggtgcctac
aatgcgcactttggagagagcattgccagcctggacgatctggacaatgatgggttccca
gatgtggccattggtgcacccaaggaggatgacttcgcaggggcggtctatatctatcat
ggtgatgccggtgggatagtccctcagtactcaatgaaactgtctgggcagaagataaat
ccagtgctccggatgtttggtcagtccatatcgggaggcattgatatggatggaaatggc
tatcctgatgtcactgttggagccttcatgtccgacagcgtggttcttctcagagcaagg
cctgtcattacggtggatgtctccatcttcctcccgggctccatcaacatcacagcgcct
cagtgtcacgacggacagcagcctgtgaactgcctgaacgtcaccacctgcttcagcttc
catggcaaacacgttccaggagagattggcctgaattatgttctgatggctgacgtggcc
aaaaaggagaagggccagatgcccagggtctactttgtgctgctgggagagaccatgggt
caggtcacagagaagctgcagctgacttacatggaggagacgtgtcgtcactatgtggcc
catgtgaagcggagggtgcaggacgtcatcagcccgatcgtgtttgaagcagcctacagc
ctcagtgagcatgtgactggagaggaggagagggaactgccgcctctgacaccagttctc
cgctggaaaaagggacaaaagattgcccaaaagaatcagactgtttttgaaaggaattgc
cgttcagaggactgtgccgcagacctgcagcttcagggtaaactgctgctctccagtatg
gatgagaaaaccctgtatctagctttgggggctgtgaagaacatctccctaaacatctct
atctccaacctcggagatgatgcctatgatgccaacgtgtccttcaatgtttcccgggag
ctcttcttcatcaacatgtggcagaaggaggagatgggcatctcctgtgagctgctggaa
tcggacttcctcaaatgcagcgtgggatttcctttcatgaggtcaaagtcaaagtatgaa
ttcagcgtgatctttgatacaagccacctgtctggggaagaggaagttctcagcttcatt
gttactgctcagagtggcaacacggagcgctctgaatccctgcatgacaacaccctcgtg
ctgatggtgccactgatgcacgaggtggacacgtccatcaccggaatcatgtctccaacc
tcctttgtatatggcgagtccgtggacgcagccaacttcattcagctggatgacctggag
tgtcactttcagcccatcaatatcacccttcaggtctacaacactggcccaagcaccctt
ccagggtcatctgtcagcatctctttccctaatcgactctcatctggtggtgcagagatg
tttcatgtccaggaaatggtggtgggccaagagaagggaaactgctctttccagaaaaac
ccaactccctgcatcatccctcaagaacaagaaaatatcttccacacaatatttgctttt
ttcacaaagtctggaagaaaagtcttggactgtgaaaaaccaggaatttcttgcctaaca
gcacactgtaactttagtgctcttgctaaagaagaaagtcgtactatagacatttacatg
ctgctgaacacagaaatactgaaaaaggacagttcgtctgtcatccagttcatgtcccgc
gccaaggtgaaggtggatcctgccctaagggtggtggaaatagctcatgggaacccagaa
gaggtgacggtggtcttcgaggccctgcacaatctggagccccgtggctacgtcgtgggg
tggatcatcgccatcagtttgttggtgggaatcctcatcttcctgctgctggccgtgctg
ctctggaagatgggcttctttcgccgaaggtacaaagaaattatcgaagctgagaagaac
cggaaagagaatgaagacagttgggactgggtccagaaaaaccagtga

DBGET integrated database retrieval system