KEGG   Homo sapiens (human): 3681Help
Entry
3681              CDS       T01001                                 

Gene name
ITGAD, ADB2, CD11D
Definition
integrin, alpha D
Orthology
K06594  
integrin alpha D
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    3681 (ITGAD)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   ICAM family
    ICAM3; intercellular adhesion molecule 3 [KO:K06486]
     alpha D beta 2 Cell adhesion molecules (CAMs)
      3681 (ITGAD)
Cellular antigens [BR:hsa04090]
 Proteins
  3681 (ITGAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 1161 aa AA seqDB search
MTFGTVLLLSVLASYHGFNLDVEEPTIFQEDAGGFGQSVVQFGGSRLVVGAPLEVVAANQ
TGRLYDCAAATGMCQPIPLHIRPEAVNMSLGLTLAASTNGSRLLACGPTLHRVCGENSYS
KGSCLLLGSRWEIIQTVPDATPECPHQEMDIVFLIDGSGSIDQNDFNQMKGFVQAVMGQF
EGTDTLFALMQYSNLLKIHFTFTQFRTSPSQQSLVDPIVQLKGLTFTATGILTVVTQLFH
HKNGARKSAKKILIVITDGQKYKDPLEYSDVIPQAEKAGIIRYAIGVGHAFQGPTARQEL
NTISSAPPQDHVFKVDNFAALGSIQKQLQEKIYAVEGTQSRASSSFQHEMSQEGFSTALT
MDGLFLGAVGSFSWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQNLV
LGAPRYQHTGKAVIFTQVSRQWRKKAEVTGTQIGSYFGASLCSVDVDSDGSTDLILIGAP
HYYEQTRGGQVSVCPLPRGRVQWQCDAVLRGEQGHPWGRFGAALTVLGDVNEDKLIDVAI
GAPGEQENRGAVYLFHGASESGISPSHSQRIASSQLSPRLQYFGQALSGGQDLTQDGLMD
LAVGARGQVLLLRSLPVLKVGVAMRFSPVEVAKAVYRCWEEKPSALEAGDATVCLTIQKS
SLDQLGDIQSSVRFDLALDPGRLTSRAIFNETKNPTLTRRKTLGLGIHCETLKLLLPDCV
EDVVSPIILHLNFSLVREPIPSPQNLRPVLAVGSQDLFTASLPFEKNCGQDGLCEGDLGV
TLSFSGLQTLTVGSSLELNVIVTVWNAGEDSYGTVVSLYYPAGLSHRRVSGAQKQPHQSA
LRLACETVPTEDEGLRSSRCSVNHPIFHEGSNGTFIVTFDVSYKATLGDRMLMRASASSE
NNKASSSKATFQLELPVKYAVYTMISRQEESTKYFNFATSDEKKMKEAEHRYRVNNLSQR
DLAISINFWVPVLLNGVAVWDVVMEAPSQSLPCVSERKPPQHSDFLTQISRSPMLDCSIA
DCLQFRCDVPSFSVQEELDFTLKGNLSFGWVRETLQKKVLVVSVAEITFDTSVYSQLPGQ
EAFMRAQMEMVLEEDEVYNAIPIIMGSSVGALLLLALITATLYKLGFFKRHYKEMLEDKP
EDTATFSGDDFSCVAPNVPLS
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcggcactgtgcttcttctgagtgtcctggcttcttatcatggattcaacctg
gatgtggaggagcctacgatcttccaggaggatgcaggcggctttgggcagagcgtggtg
cagttcggtggatctcgactcgtggtgggagcacccctggaggtggtggcggccaaccag
acgggacggctgtatgactgcgcagctgccaccggcatgtgccagcccatcccgctgcac
atccgccctgaggccgtgaacatgtccttgggcctgaccctggcagcctccaccaacggc
tcccggctcctggcctgtggcccgaccctgcacagagtctgtggggagaactcatactca
aagggttcctgcctcctgctgggctcgcgctgggagatcatccagacagtccccgacgcc
acgccagagtgtccacatcaagagatggacatcgtcttcctgattgacggctctggaagc
attgaccaaaatgactttaaccagatgaagggctttgtccaagctgtcatgggccagttt
gagggcactgacaccctgtttgcactgatgcagtactcaaacctcctgaagatccacttc
accttcacccaattccggaccagcccgagccagcagagcctggtggatcccatcgtccaa
ctgaaaggcctgacgttcacggccacgggcatcctgacagtggtgacacagctatttcat
cataagaatggggcccgaaaaagtgccaagaagatcctcattgtcatcacagatgggcag
aagtacaaagaccccctggaatacagtgatgtcatcccccaggcagagaaggctggcatc
atccgctacgctatcggggtgggacacgctttccagggacccactgccaggcaggagctg
aataccatcagctcagcgcctccgcaggaccacgtgttcaaggtggacaactttgcagcc
cttggcagcatccagaagcagctgcaggagaagatctatgcagttgagggaacccagtcc
agggcaagcagctccttccagcacgagatgtcccaagaaggcttcagcacagccctcaca
atggatggcctcttcctgggggctgtggggagctttagctggtctggaggtgccttcctg
tatcccccaaatatgagccccaccttcatcaacatgtctcaggagaatgtggacatgagg
gactcttacctgggttactccaccgagctagccctgtggaagggggtacagaacctggtc
ctgggggccccccgctaccagcataccgggaaggctgtcatcttcacccaggtgtccagg
caatggaggaagaaggccgaagtcacagggacgcagatcggctcctacttcggggcctcc
ctctgctccgtggatgtggacagcgatggcagcaccgacctgatcctcattggggccccc
cattactatgagcagacccgagggggccaggtgtccgtgtgtcccttgcctagggggagg
gtgcagtggcagtgtgacgctgttctccgtggtgagcagggccacccctggggccgcttt
ggggcagccctgacagtgttgggggatgtgaatgaggacaagctgatagacgtggccatt
ggggccccgggagagcaggagaaccggggtgctgtctacctgtttcacggagcctcagaa
tccggcatcagcccctcccacagccagcggattgccagctcccagctctcccccaggctg
cagtattttgggcaggcgctgagtgggggtcaggacctcacccaggatggactgatggac
ctggccgtgggggcccggggccaggtgctcctgctcaggagtctgccggtgctgaaagtg
ggggtggccatgagattcagccctgtggaggtggccaaggctgtgtaccggtgctgggaa
gagaagcccagtgccctggaagctggggacgccaccgtctgtctcaccatccagaaaagc
tcactggaccagctaggtgacatccaaagctctgtcaggtttgatctggcactggaccca
ggtcgtctgacttctcgtgccattttcaatgaaaccaagaaccccactttgactcgaaga
aaaaccctgggactggggattcactgtgaaaccctgaagctgcttttgccagattgtgtg
gaggatgtggtgagccccatcattctgcacctcaacttctcactggtgagagagcccatc
ccctccccccagaacctgcgtcctgtgctggccgtgggctcacaagacctcttcactgct
tctctccccttcgagaagaactgtgggcaagatggcctctgtgaaggggacctgggtgtc
accctcagcttctcaggcctgcagaccctgaccgtggggagctccctggagctcaacgtg
attgtgactgtgtggaacgcaggtgaggattcctacggaaccgtggtcagcctctactat
ccagcagggctgtcgcaccgacgggtgtcaggagcccagaagcagccccatcagagtgcc
ctgcgcctggcatgtgagacagtgcccactgaggatgagggcctaagaagcagccgctgc
agtgtcaaccaccccatcttccatgagggctctaacggcaccttcatagtcacattcgat
gtctcctacaaggccaccctgggagacaggatgcttatgagggccagtgcaagcagtgag
aacaataaggcttcaagcagcaaggccaccttccagctggagctcccggtgaagtatgca
gtctacaccatgatcagcaggcaggaagaatccaccaagtacttcaactttgcaacctcc
gatgagaagaaaatgaaagaggctgagcatcgataccgtgtgaataacctcagccagcga
gatctggccatcagcattaacttctgggttcctgtcctgctgaacggggtggctgtgtgg
gatgtggtcatggaggccccatctcagagtctcccctgtgtttcagagagaaaacctccc
cagcattctgacttcctgacccagatttcaagaagtcccatgctggactgctccattgct
gactgcctgcagttccgctgtgacgtcccctccttcagcgtccaggaggagctggatttc
accctgaagggcaatctcagtttcggctgggtccgcgagacattgcagaagaaggtgttg
gtcgtgagtgtggctgaaattacgttcgacacatccgtgtactcccagcttccaggacag
gaggcatttatgagagctcagatggagatggtgctagaagaagacgaggtctacaatgcc
attcccatcatcatgggcagctctgtgggggctctgctactgctggcgctcatcacagcc
acactgtacaagcttggcttcttcaaacgccactacaaggaaatgctggaggacaagcct
gaagacactgccacattcagtggggacgatttcagctgtgtggccccaaatgtgcctttg
tcctaa

DBGET integrated database retrieval system