KEGG   Homo sapiens (human): 3682Help
Entry
3682              CDS       T01001                                 

Gene name
ITGAE, CD103, HUMINAE
Definition
integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide)
Orthology
K06524  
integrin alpha E
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    3682 (ITGAE)
Cell adhesion molecules and their ligands [BR:hsa04516]
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type I classic cadherins
    CDHE, CDH1; cadherin 1, type 1, E-cadherin [KO:K05689]
     alpha E beta 7 Cell adhesion molecules (CAMs)
      3682 (ITGAE)
Cellular antigens [BR:hsa04090]
 Proteins
  3682 (ITGAE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13
AA seq 1179 aa AA seqDB search
MWLFHTLLCIASLALLAAFNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRT
KRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSS
ELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARQRRAL
EKEEEEDKEEEEDEEEEEAGTEIAIILDGSGSIDPPDFQRAKDFISNMMRNFYEKCFECN
FALVQYGGVIQTEFDLRDSQDVMASLARVQNITQVGSVTKTASAMQHVLDSIFTSSHGSR
RKASKVMVVLTDGGIFEDPLNLTTVINSPKMQGVERFAIGVGEEFKSARTARELNLIASD
PDETHAFKVTNYMALDGLLSKLRYNIISMEGTVGDALHYQLAQIGFSAQILDERQVLLGA
VGAFDWSGGALLYDTRSRRGRFLNQTAAAAADAEAAQYSYLGYAVAVLHKTCSLSYIAGA
PRYKHHGAVFELQKEGREASFLPVLEGEQMGSYFGSELCPVDIDMDGSTDFLLVAAPFYH
VHGEEGRVYVYRLSEQDGSFSLARILSGHPGFTNARFGFAMAAMGDLSQDKLTDVAIGAP
LEGFGADDGASFGSVYIYNGHWDGLSASPSQRIRASTVAPGLQYFGMSMAGGFDISGDGL
ADITVGTLGQAVVFRSRPVVRLKVSMAFTPSALPIGFNGVVNVRLCFEISSVTTASESGL
REALLNFTLDVDVGKQRRRLQCSDVRSCLGCLREWSSGSQLCEDLLLMPTEGELCEEDCF
SNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVS
QQELVVGLTKELTLNINLTNSGEDSYMTSMALNYPRNLQLKRMQKPPSPNIQCDDPQPVA
SVLIMNCRIGHPVLKRSSAHVSVVWQLEENAFPNRTADITVTVTNSNERRSLANETHTLQ
FRHGFVAVLSKPSIMYVNTGQGLSHHKEFLFHVHGENLFGAEYQLQICVPTKLRGLQVVA
VKKLTRTQASTVCTWSQERACAYSSVQHVEEWHSVSCVIASDKENVTVAAEISWDHSEEL
LKDVTELQILGEISFNKSLYEGLNAENHRTKITVVFLKDEKYHSLPIIIKGSVGGLLVLI
VILVILFKCGFFKRKYQQLNLESIRKAQLKSENLLEEEN
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcttccacactctgctctgcatagccagcctggccctgctggccgctttcaat
gtggatgtggcccggccctggctcacgcccaagggaggtgcccctttcgtgctcagctcc
cttctgcaccaagaccccagcaccaaccagacctggctcctggtcaccagccccagaacc
aagaggacaccagggcccctccatcgatgttcccttgtccaggatgaaatcctttgccat
cctgtagagcatgtccccatccccaaggggaggcaccggggagtgaccgttgtccggagc
caccacggtgttttgatatgcattcaagtgctggtccggcggcctcacagcctcagctca
gaactcacaggcacctgtagcctcctgggccctgacctccgtccccaggctcaggccaac
ttcttcgaccttgaaaatctcctggatccagatgcacgtgtggacactggagactgctac
agcaacaaagaaggcggtggagaagacgatgtgaacacagccaggcagcgccgggctctg
gagaaggaggaggaggaagacaaggaggaggaggaagacgaggaggaggaggaagctggc
accgagattgccatcatcctggatggctcaggaagcattgatcccccagactttcagaga
gccaaagacttcatctccaacatgatgaggaacttctatgaaaagtgttttgagtgcaac
tttgccttggtgcagtatggaggagtgatccagactgagtttgaccttcgggacagccag
gatgtgatggcctccctcgccagagtccagaacatcactcaagtggggagtgtcaccaag
actgcctcagccatgcaacacgtcttagacagcatcttcacctcaagccacggctccagg
agaaaggcatccaaggtcatggtggtgctcaccgatggtggcatattcgaggaccccctc
aaccttacgacagtcatcaactcccccaaaatgcagggtgttgagcgctttgccattggg
gtgggagaagaatttaagagtgctaggactgcgagggaactgaacctgatcgcctcagac
ccggatgagacccatgctttcaaggtgaccaactacatggcgctggatgggctgctgagc
aaactgcggtacaacatcatcagcatggaaggcacggttggagacgcccttcactaccag
ctggcacagattggcttcagtgctcagatcctggatgagcggcaggtgctgctcggcgcc
gtcggggcctttgactggtccggaggggcgttgctctacgacacacgcagccgccggggc
cgcttcctgaaccagacagcggcggcggcggcagacgcggaggctgcgcagtacagctac
ctgggttacgctgtggccgtgctgcacaagacctgcagcctctcctacatcgcgggggct
ccacggtacaaacatcatggggccgtgtttgagctccagaaggagggcagagaggccagc
ttcctgccagtgctggagggagagcagatggggtcctattttggctctgagctgtgccct
gtggacattgacatggatggaagcacggacttcttgctggtggctgctccattttaccac
gttcatggagaagaaggcagagtctacgtgtaccgtctcagcgagcaggatggttctttc
tccttggcacgcatactgagtgggcaccccgggttcaccaatgcccgctttggctttgcc
atggcggctatgggggatctcagtcaggataagctcacagatgtggccatcggggccccc
ctggaaggttttggggcagatgatggtgccagcttcggcagtgtgtatatctacaatgga
cactgggacggcctctccgccagcccctcgcagcggatcagagcctccacggtggcccca
ggactccagtacttcggcatgtccatggctggtggctttgatattagtggcgacggcctt
gccgacatcaccgtgggcactctgggccaggcggttgtgttccgctcccggcctgtggtt
cgcctgaaggtctccatggccttcacccccagcgcactgcccatcggcttcaacggcgtc
gtgaatgtccgtttatgttttgaaatcagctctgtaaccacagcctctgagtcaggcctc
cgcgaggcacttctcaacttcacgctggatgtggatgtggggaagcagaggagacggctg
cagtgttcagacgtaagaagctgtctgggctgcctgagggagtggagcagcggatcccag
ctttgtgaggacctcctgctcatgcccacagagggagagctctgtgaggaggactgcttc
tccaatgccagtgtcaaagtcagctaccagctccagacccctgagggacagacggaccat
ccccagcccatcctggaccgctacactgagccctttgccatcttccagctgccctatgag
aaggcctgcaagaataagctgttttgtgtcgcagaattacagttggccaccaccgtctct
cagcaggagttggtggtgggtctcacaaaggagctgaccctgaacattaacctaactaac
tccggggaagattcctacatgacaagcatggccttgaattaccccagaaacctgcagttg
aagaggatgcaaaagcctccctctccaaacattcagtgtgatgaccctcagccggttgct
tctgtcctgatcatgaactgcaggattggtcaccccgtcctcaagaggtcatctgctcat
gtttcagtcgtttggcagctagaggagaatgcctttccaaacaggacagcagacatcact
gtgactgtcaccaattccaatgaaagacggtctttggccaacgagacccacacccttcaa
ttcaggcatggcttcgttgcagttctgtccaaaccatccataatgtacgtgaacacaggc
caggggctttctcaccacaaagaattcctcttccatgtacatggggagaacctctttgga
gcagaataccagttgcaaatttgcgtcccaaccaaattacgaggtctccaggttgtagca
gtgaagaagctgacgaggactcaggcctccacggtgtgcacctggagtcaggagcgcgct
tgtgcgtacagttcggttcagcatgtggaagaatggcattcagtgagctgtgtcatcgct
tcagataaagaaaatgtcaccgtggctgcagagatctcctgggatcactctgaggagtta
ctaaaagatgtaactgaactgcagatccttggtgaaatatctttcaacaaatctctatat
gagggactgaatgcagagaaccacagaactaagatcactgtcgtcttcctgaaagatgag
aagtaccattctttgcctatcatcattaaaggcagcgttggtggacttctggtgttgatc
gtgattctggtcatcctgttcaagtgtggcttttttaaaagaaaatatcaacaactgaac
ttggagagcatcaggaaggcccagctgaaatcagagaatctgctcgaagaagagaattag

DBGET integrated database retrieval system