KEGG   Homo sapiens (human): 369Help
Entry
369               CDS       T01001                                 

Gene name
ARAF, A-RAF, ARAF1, PKS2, RAFA1
Definition
v-raf murine sarcoma 3611 viral oncogene homolog (EC:2.7.11.1)
Orthology
K08845  
A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
FoxO signaling pathway
Vascular smooth muscle contraction
Natural killer cell mediated cytotoxicity
Long-term potentiation
Serotonergic synapse
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Alcoholism
Hepatitis C
Pathways in cancer
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Disease
H00523  
Noonan syndrome and related disorders
Class
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:hsa04012]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:hsa04914]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Organismal Systems; Nervous system; Long-term potentiation [PATH:hsa04720]
Organismal Systems; Nervous system; Long-term depression [PATH:hsa04730]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Colorectal cancer [PATH:hsa05210]
Human Diseases; Cancers; Pancreatic cancer [PATH:hsa05212]
Human Diseases; Cancers; Glioma [PATH:hsa05214]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:hsa05221]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:hsa05220]
Human Diseases; Cancers; Melanoma [PATH:hsa05218]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
Human Diseases; Cancers; Bladder cancer [PATH:hsa05219]
Human Diseases; Cancers; Prostate cancer [PATH:hsa05215]
Human Diseases; Cancers; Endometrial cancer [PATH:hsa05213]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:hsa05223]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.4-p11.2
AA seq 609 aa AA seqDB search
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRQQPSRFYHSVQDLSGGSRQHEAPSNRPLN
ELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQ
SFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYR
DSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVSQPTAEQAQAFKNEMQV
LRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGM
DYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEV
IRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSN
CPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPAC
LLSAARLVP
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggagccaccacggggcccccctgccaatggggccgagccatcccgggcagtgggcacc
gtcaaagtatacctgcccaacaagcaacgcacggtggtgactgtccgggatggcatgagt
gtctacgactctctagacaaggccctgaaggtgcggggtctaaatcaggactgctgtgtg
gtctaccgactcatcaagggacgaaagacggtcactgcctgggacacagccattgctccc
ctggatggcgaggagctcattgtcgaggtccttgaagatgtcccgctgaccatgcacaat
tttgtacggaagaccttcttcagcctggcgttctgtgacttctgccttaagtttctgttc
catggcttccgttgccaaacctgtggctacaagttccaccagcattgttcctccaaggtc
cccacagtctgtgttgacatgagtaccaaccgccaacagccctcaaggttctaccacagt
gtccaggatttgtccggaggctccagacagcatgaggctccctcgaaccgccccctgaat
gagttgctaaccccccagggtcccagcccccgcacccagcactgtgacccggagcacttc
cccttccctgccccagccaatgcccccctacagcgcatccgctccacgtccactcccaac
gtccatatggtcagcaccacggcccccatggactccaacctcatccagctcactggccag
agtttcagcactgatgctgccggtagtagaggaggtagtgatggaaccccccgggggagc
cccagcccagccagcgtgtcctcggggaggaagtccccacattccaagtcaccagcagag
cagcgcgagcggaagtccttggccgatgacaagaagaaagtgaagaacctggggtaccgg
gactcaggctattactgggaggtaccacccagtgaggtgcagctgctgaagaggatcggg
acgggctcgtttggcaccgtgtttcgagggcggtggcatggcgatgtggccgtgaaggtg
ctcaaggtgtcccagcccacagctgagcaggcccaggctttcaagaatgagatgcaggtg
ctcaggaagacgcgacatgtcaacatcttgctgtttatgggcttcatgacccggccggga
tttgccatcatcacacagtggtgtgagggctccagcctctaccatcacctgcatgtggcc
gacacacgcttcgacatggtccagctcatcgacgtggcccggcagactgcccagggcatg
gactacctccatgccaagaacatcatccaccgagatctcaagtctaacaacatcttccta
catgaggggctcacggtgaagatcggtgactttggcttggccacagtgaagactcgatgg
agcggggcccagcccttggagcagccctcaggatctgtgctgtggatggcagctgaggtg
atccgtatgcaggacccgaacccctacagcttccagtcagacgtctatgcctacggggtt
gtgctctacgagcttatgactggctcactgccttacagccacattggctgccgtgaccag
attatctttatggtgggccgtggctatctgtccccggacctcagcaaaatctccagcaac
tgccccaaggccatgcggcgcctgctgtctgactgcctcaagttccagcgggaggagcgg
cccctcttcccccagatcctggccacaattgagctgctgcaacggtcactccccaagatt
gagcggagtgcctcggaaccctccttgcaccgcacccaggccgatgagttgcctgcctgc
ctactcagcgcagcccgccttgtgccttag

DBGET integrated database retrieval system