KEGG   Homo sapiens (human): 369Help
Entry
369               CDS       T01001                                 

Gene name
ARAF, A-RAF, ARAF1, PKS2, RAFA1
Definition
v-raf murine sarcoma 3611 viral oncogene homolog (EC:2.7.11.1)
Orthology
K08845  
A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
FoxO signaling pathway
Vascular smooth muscle contraction
Natural killer cell mediated cytotoxicity
Long-term potentiation
Serotonergic synapse
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Alcoholism
Hepatitis C
Pathways in cancer
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Disease
H00523  
Noonan syndrome and related disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    369 (ARAF)
   04068 FoxO signaling pathway
    369 (ARAF)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    369 (ARAF)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    369 (ARAF)
  Endocrine system
   04910 Insulin signaling pathway
    369 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    369 (ARAF)
  Circulatory system
   04270 Vascular smooth muscle contraction
    369 (ARAF)
  Nervous system
   04726 Serotonergic synapse
    369 (ARAF)
   04720 Long-term potentiation
    369 (ARAF)
   04730 Long-term depression
    369 (ARAF)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    369 (ARAF)
   05205 Proteoglycans in cancer
    369 (ARAF)
   05210 Colorectal cancer
    369 (ARAF)
   05212 Pancreatic cancer
    369 (ARAF)
   05214 Glioma
    369 (ARAF)
   05221 Acute myeloid leukemia
    369 (ARAF)
   05220 Chronic myeloid leukemia
    369 (ARAF)
   05218 Melanoma
    369 (ARAF)
   05211 Renal cell carcinoma
    369 (ARAF)
   05219 Bladder cancer
    369 (ARAF)
   05215 Prostate cancer
    369 (ARAF)
   05213 Endometrial cancer
    369 (ARAF)
   05223 Non-small cell lung cancer
    369 (ARAF)
  Substance dependence
   05034 Alcoholism
    369 (ARAF)
  Infectious diseases
   05160 Hepatitis C
    369 (ARAF)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     369 (ARAF)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  RAF family [OT]
   369 (ARAF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.4-p11.2
AA seq 609 aa AA seqDB search
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRQQPSRFYHSVQDLSGGSRQHEAPSNRPLN
ELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQ
SFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYR
DSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVSQPTAEQAQAFKNEMQV
LRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGM
DYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEV
IRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSN
CPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPAC
LLSAARLVP
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggagccaccacggggcccccctgccaatggggccgagccatcccgggcagtgggcacc
gtcaaagtatacctgcccaacaagcaacgcacggtggtgactgtccgggatggcatgagt
gtctacgactctctagacaaggccctgaaggtgcggggtctaaatcaggactgctgtgtg
gtctaccgactcatcaagggacgaaagacggtcactgcctgggacacagccattgctccc
ctggatggcgaggagctcattgtcgaggtccttgaagatgtcccgctgaccatgcacaat
tttgtacggaagaccttcttcagcctggcgttctgtgacttctgccttaagtttctgttc
catggcttccgttgccaaacctgtggctacaagttccaccagcattgttcctccaaggtc
cccacagtctgtgttgacatgagtaccaaccgccaacagccctcaaggttctaccacagt
gtccaggatttgtccggaggctccagacagcatgaggctccctcgaaccgccccctgaat
gagttgctaaccccccagggtcccagcccccgcacccagcactgtgacccggagcacttc
cccttccctgccccagccaatgcccccctacagcgcatccgctccacgtccactcccaac
gtccatatggtcagcaccacggcccccatggactccaacctcatccagctcactggccag
agtttcagcactgatgctgccggtagtagaggaggtagtgatggaaccccccgggggagc
cccagcccagccagcgtgtcctcggggaggaagtccccacattccaagtcaccagcagag
cagcgcgagcggaagtccttggccgatgacaagaagaaagtgaagaacctggggtaccgg
gactcaggctattactgggaggtaccacccagtgaggtgcagctgctgaagaggatcggg
acgggctcgtttggcaccgtgtttcgagggcggtggcatggcgatgtggccgtgaaggtg
ctcaaggtgtcccagcccacagctgagcaggcccaggctttcaagaatgagatgcaggtg
ctcaggaagacgcgacatgtcaacatcttgctgtttatgggcttcatgacccggccggga
tttgccatcatcacacagtggtgtgagggctccagcctctaccatcacctgcatgtggcc
gacacacgcttcgacatggtccagctcatcgacgtggcccggcagactgcccagggcatg
gactacctccatgccaagaacatcatccaccgagatctcaagtctaacaacatcttccta
catgaggggctcacggtgaagatcggtgactttggcttggccacagtgaagactcgatgg
agcggggcccagcccttggagcagccctcaggatctgtgctgtggatggcagctgaggtg
atccgtatgcaggacccgaacccctacagcttccagtcagacgtctatgcctacggggtt
gtgctctacgagcttatgactggctcactgccttacagccacattggctgccgtgaccag
attatctttatggtgggccgtggctatctgtccccggacctcagcaaaatctccagcaac
tgccccaaggccatgcggcgcctgctgtctgactgcctcaagttccagcgggaggagcgg
cccctcttcccccagatcctggccacaattgagctgctgcaacggtcactccccaagatt
gagcggagtgcctcggaaccctccttgcaccgcacccaggccgatgagttgcctgcctgc
ctactcagcgcagcccgccttgtgccttag

DBGET integrated database retrieval system