KEGG   Homo sapiens (human): 3692Help
Entry
3692              CDS       T01001                                 

Gene name
EIF6, CAB, EIF3A, ITGB4BP, b(2)gcn, eIF-6, p27(BBP), p27BBP
Definition
(RefSeq) eukaryotic translation initiation factor 6 (EC:3.6.5.3)
  KO
K03264  
translation initiation factor 6
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    3692 (EIF6)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    3692 (EIF6)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-6
    3692 (EIF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q12
AA seq 245 aa AA seqDB search
MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIG
RMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPD
LDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP
LVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSL
IDSLT
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggcggtccgagcttcgttcgagaacaactgtgagatcggctgctttgccaagctcacc
aacacctactgtctggtagcgatcggaggctcagagaacttctacagtgtgttcgagggc
gagctctccgataccatccccgtggtgcacgcgtctatcgccggctgccgcatcatcggg
cgcatgtgtgtggggaacaggcacggtctcctggtacccaacaataccaccgaccaggag
ctgcaacacattcgcaacagcctcccagacacagtgcagattaggcgggtggaggagcgg
ctctcagccttgggcaatgtcaccacctgcaatgactacgtggccttggtccacccagac
ttggacagggagacagaagaaattctggcagatgtgctcaaggtggaagtcttcagacag
acagtggccgaccaggtgctagtaggaagctactgtgtcttcagcaatcagggagggctg
gtgcatcccaagacttcaattgaagaccaggatgagctgtcctctcttcttcaagtcccc
cttgtggcggggactgtgaaccgaggcagtgaggtgattgctgctgggatggtggtgaat
gactggtgtgccttctgtggcctggacacaaccagcacagagctgtcagtggtggagagt
gtcttcaagctgaatgaagcccagcctagcaccattgccaccagcatgcgggattccctc
attgacagcctcacctga

DBGET integrated database retrieval system